KEGG   Streptococcus pneumoniae 670-6B (serotype 6B): SP670_2072Help
Entry
SP670_2072        CDS       T01308                                 

Definition
(GenBank) aspartate aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
snb  Streptococcus pneumoniae 670-6B (serotype 6B)
Pathway
snb00220  Arginine biosynthesis
snb00250  Alanine, aspartate and glutamate metabolism
snb00290  Valine, leucine and isoleucine biosynthesis
snb01100  Metabolic pathways
snb01110  Biosynthesis of secondary metabolites
snb01130  Biosynthesis of antibiotics
snb01210  2-Oxocarboxylic acid metabolism
snb01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:snb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SP670_2072
   00290 Valine, leucine and isoleucine biosynthesis
    SP670_2072
   00220 Arginine biosynthesis
    SP670_2072
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:snb01007]
    SP670_2072
Enzymes [BR:snb01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     SP670_2072
    2.6.1.66  valine---pyruvate transaminase
     SP670_2072
Amino acid related enzymes [BR:snb01007]
 Aminotransferase (transaminase)
  Class I
   SP670_2072
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1 MHC_II_alpha
Motif
Other DBs
NCBI-ProteinID: ADM92124
LinkDB All DBs
Position
complement(1934275..1935489)
Genome map
AA seq 404 aa AA seqDB search
MKEYNKSSKLEHVAYDIRGPVLEEAMRMRANGEKILRLNTGNPAEFGFTAPDEVIHDLIM
NARDSEGYSDSKGIFSARKAIMQYCQLKKFPNVDIDDIYLGNGVSELIVMSMQGLLDNGD
EVLVPMPDYPLWTAAVSLAGGNAVHYICDEAVEWYPDIDDIKSKITSNTKAIVLINPNNP
TGALYPKELLLGIIEIARQNDLIIFADEIYDRMVMDGHVHTPVASLAPDVFCVSMNGLSK
SHRIAGFRVGWMVLSGPKTHVKGYIEGLNMLSNMRLCSNVLAQQVVQTSLGGHQSVDELL
LPGGRIYEQRNFIYNAIQDIPGLSAVKPKAGLYIFPKIDRNMYRIDDDEQFVLDFLKQEK
VLLVHGRGFNWQEPDHFRIVYLPRVDELAQIQEKMTRFLKQYRR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaatataacaagtctagtaagttagagcatgttgcttatgatatccgtggtcct
gtattggaagaagccatgcggatgcgagcgaatggagaaaagattttacgtctgaataca
ggaaatccagcagaatttggctttacagcgccagacgaggtcattcatgacttgattatg
aatgcgcgtgatagtgaaggctattctgactccaaagggattttctcagcccgtaaggcc
atcatgcagtattgccagctgaagaaattcccaaacgtagatattgatgatatttacctt
ggaaatggtgtcagtgagttgattgtcatgtccatgcaggggcttttggacaatggggat
gaggtcttagtgccaatgccagactatcctctatggacggcggctgtcagcctagctgga
ggaaatgccgttcactatatctgtgatgaagctgtggaatggtacccagatattgacgat
atcaagtcaaaaatcacttccaataccaaggcaattgtccttatcaatccaaataaccca
actggagccctttatcctaaggaactcttgctggggattattgagattgcccgtcaaaac
gatttgattatctttgcggatgaaatctatgaccgcatggtaatggacggacatgtgcat
acgcctgtggcgagcttggcaccagatgtcttctgtgtcagcatgaatggtctgtcaaaa
tcccaccgcatagcaggtttccgtgtgggttggatggtcttgtctggccctaagactcat
gttaagggctatatcgaagggctcaatatgctgtccaatatgcgcctttgctctaacgtt
ttggcccaacaagtcgtacaaacttccttggggggtcaccaatcagtcgatgaattgctt
cttcctggtggacgaatctacgagcaaagaaatttcatctataatgccattcaagatatt
ccaggtttgtctgccgttaaacccaaggcggggctctatatcttcccaaaaatcgaccgc
aatatgtaccgtatcgatgatgatgagcagtttgtccttgatttcttgaagcaggaaaag
gttctcttggttcatggtcgaggctttaactggcaggaaccagaccacttccgtatcgtt
taccttcctcgtgttgatgagttagcccaaatccaagaaaagatgactcgtttcttgaaa
cagtatcgtagatag

DBGET integrated database retrieval system