KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_10728Help
Entry
HMPREF0837_10728  CDS       T01259                                 

Definition
(GenBank) putative chlorophyll synthesis pathway protein BchC
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Pathway
snc00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:snc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    HMPREF0837_10728
Enzymes [BR:snc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     HMPREF0837_10728
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     HMPREF0837_10728
    1.1.1.-  
     HMPREF0837_10728
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C TrkA_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ADI68956
UniProt: D6ZQR7
LinkDB All DBs
Position
complement(658307..659350)
Genome map
AA seq 347 aa AA seqDB search
MATMKAARWHAAKDVRIQEIEVPEVLPHQVKVAVKFTGICGTDLHEFLDGPIFIPTDEHV
YSGQKAPVTLGHEFSGEIIEVGSDVTRVKVGDRVAVEPILAKNNLVGDYNLDPNLNFVGL
AADGGFAKYCVLDGDLVHVIPDSLSYEQAALTEPAAVAVYAVRQSSLKAGDTAVVFGLGP
IGLLIVEALRAAGASKIYAVELSPERQAKAEELGAIVVRPEEGETAVEAIHRLTNGGVDV
SYEVTGVPVVLGQALAAVHKAGECMVVSIWEREANINPNEFAIQEKTLKGIIAYRHIFPK
VLELMEQGYFSAEKLVTKKIKLENIVEEDFIELTQDKSQIKILVEPE
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggctacaatgaaggcagctcgctggcatgcagcgaaagatgttcgtattcaagaaata
gaagttcctgaagtacttccgcaccaagtaaaagttgcagttaagttcacaggaatttgt
ggtactgacctccatgaatttttagatggacctatctttatcccaacagatgagcacgtc
tattctggtcaaaaagcaccggtaacactgggacatgaattttctggtgaaatcatagaa
gtcggaagcgatgttacccgtgttaaagttggtgatcgtgttgctgtggaaccaattcta
gctaaaaataacttagttggtgattataatttggatccaaaccttaattttgtcggtttg
gctgcagacggtggatttgccaaatattgtgttttagacggtgacttagtacatgtcatt
ccagatagtttgagctatgagcaagctgctcttactgaacccgctgctgttgcagtctat
gctgttcgtcaatcttctttgaaggctggcgatacagctgttgtctttggtttaggcccg
attggtctattaattgtagaagctcttcgtgcagctggtgcttctaagatttatgctgtt
gaactatcacctgaacgtcaagcaaaagctgaagagttaggagctatcgttgtccgtccg
gaagaaggtgaaacagctgttgaagctattcatcgtttaacaaacggtggtgtagatgtt
tcttatgaagtaacgggtgtgccagtagttttaggacaagccttagctgccgtacataaa
gcaggtgagtgcatggtggtctctatctgggaacgagaagcaaatattaatccgaatgaa
tttgcaatccaagaaaagacactaaaaggaatcattgcttatcgtcatatcttccctaaa
gtattagaattgatggaacaaggctacttctctgctgaaaaattagttactaagaaaatt
aaattggaaaatatcgtcgaagaagactttatcgaattaactcaagataagtcacaaatt
aaaattttggtagaaccagaataa

DBGET integrated database retrieval system