KEGG   Streptococcus pneumoniae TCH8431/19A: HMPREF0837_11115Help
Entry
HMPREF0837_11115  CDS       T01259                                 

Definition
(GenBank) hypothetical protein
Organism
snc  Streptococcus pneumoniae TCH8431/19A
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RE_ApaLI
Motif
Other DBs
NCBI-ProteinID: ADI69343
UniProt: D6ZRV4
LinkDB All DBs
Position
complement(1019817..1019951)
Genome map
AA seq 44 aa AA seqDB search
MANDNKSHYLIYRVLGISFEEGENIDLYQNKGRFLYKYAGSFLE
NT seq 135 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatgataataagagccattatttgatatacagagttttaggtatttcatttgaa
gaaggagaaaatatcgatttgtatcaaaataaaggtcgttttttatacaaatatgctggt
tcatttttagaataa

DBGET integrated database retrieval system