KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_11665Help
Entry
HMPREF0837_11665  CDS       T01259                                 

Gene name
rpiA
Definition
(GenBank) ribose 5-phosphate isomerase A
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Pathway
snc00030  Pentose phosphate pathway
snc01100  Metabolic pathways
snc01110  Biosynthesis of secondary metabolites
snc01120  Microbial metabolism in diverse environments
snc01130  Biosynthesis of antibiotics
snc01200  Carbon metabolism
snc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:snc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    HMPREF0837_11665 (rpiA)
Enzymes [BR:snc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     HMPREF0837_11665 (rpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rib_5-P_isom_A DeoRC
Motif
Other DBs
NCBI-ProteinID: ADI69893
UniProt: D6ZLX9
LinkDB All DBs
Position
complement(1532603..1533343)
Genome map
AA seq 246 aa AA seqDB search
MNKKRFHSKIRTENDGGKSVENLKKMAGIKAAEFVSDGMVVGLGTGSTAYYFVEEIGRRI
KEEGLQITAVTTSSVTTKQAEGLNIPLKSIDQVDFVDVTVDGADEVDSQFNGIKGGGGAL
LMEKVVATPSKEYIWVVDESKLVEKLGAFKLPVEVVQYGAEQVFRHFERAGYKPSFREKD
GQRFVTDMQNFIIDLALDVIENPIAFGQELDHVVGVVEHGLFNQMVDKVIVAGRDGVQIS
TSKKGK
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
ttgaataaaaagcggtttcatagtaaaataagaactgagaatgatggaggtaaatcggtg
gaaaatctgaagaaaatggcaggtatcaaggctgctgagttcgtgagcgatggaatggtc
gttggacttggaacaggctcgactgcctattattttgtcgaagaaatcggtcgtcgtatc
aaggaagaaggattgcagattacagctgtaacaacttctagtgtgaccactaaacaggca
gaaggccttaatatcccgctcaagtctattgaccaagtagactttgtcgatgtgacggtt
gatggcgcggatgaagtggatagtcagtttaatggaatcaaaggcggtggtggtgccctt
ctcatggaaaaggtggtcgcaacaccatcaaaagaatacatttgggtggtggatgaaagc
aagctggtcgaaaaactaggtgcttttaaattgccagtagaagtggttcagtatggtgca
gagcaggtctttcgtcattttgaacgagctggctacaaaccaagtttccgtgaaaaagac
ggccaacgttttgtgacggatatgcagaattttatcattgacctcgccttggatgtcatt
gaaaatccaattgcttttggacaagaattggatcatgtcgttggtgttgtggagcatggt
ttattcaaccaaatggtggataaggtaatcgttgctggacgggatggagttcagatttca
acttcaaaaaaaggaaaatag

DBGET integrated database retrieval system