KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_11976Help
Entry
HMPREF0837_11976  CDS       T01259                                 

Definition
(GenBank) kinase domain protein
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Brite
KEGG Orthology (KO) [BR:snc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:snc01001]
    HMPREF0837_11976
Enzymes [BR:snc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     HMPREF0837_11976
Protein kinases [BR:snc01001]
 Serine/threonine kinases: Other
  Bacterial family
   HMPREF0837_11976
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Kinase-like RIO1 Kdo Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: ADI70204
UniProt: D6ZMW4
LinkDB All DBs
Structure
PDB: 

Position
complement(1815148..1817127)
Genome map
AA seq 659 aa AA seqDB search
MIQIGKIFAGRYRIVKQIGRGGMADVYLAKDLILDGEEVAVKVLRTNYQTDPIAVARFQR
EARAMADLDHPHIVRITDIGEEDGQQYLAMEYVAGLDLKRYIKEHYPLSNEEAVRIMGQI
LLAMRLAHTRGIVHRDLKPQNILLTPDGTAKVTDFGIAVAFAETSLTQTNSMLGSVHYLS
PEQARGSKATVQSDIYAMGIIFYEMLTGHIPYDGDSAVTIALQHFQKPLPSVIAENPSVP
QALENVIIKATAKKLTNRYRSVSEMYVDLSSSLSYNRRNESKLIFDETSKADTKTLPKVS
QSTLTSIPKVQAQTEHKSIKNPSQAVTEETYQPQAPKKHRFKMRYLILLASLVLVAASLI
WILSRTPATIAIPDVAGQTVAEAKATLKKANFEIGEEKTEASEKVEEGRIIRTDPGAGTG
RKEGKKINLVVSSGKQSFQISNYVGRKSSDVIAELKEKKVPDNLIKIEEEESNESEAGTV
LKQSLPEGTTYDLSKATQIVLTVAKKATTIQLGNYIGRNSTEVISELKQKKVPENLIKIE
EEESSESEPGTIMKQSPGAGTTYDVSKPTQIVLTVAKKVTSVAMPSYIGSSLEFTKNNLI
QIVGIKEANIEVVEVTTAPAGSAEGMVVEQSPRAGEKVDLNKTRVKISIYKPKTTSATP
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgatccaaatcggcaagatttttgccggacgctatcggattgtcaaacagattggtcga
ggaggcatggcggatgtctacctagccaaagacttaatcttagatggggaagaagtggca
gtgaaggttctgaggaccaactaccagacggacccgatagctgtagctcgttttcagcgt
gaagcgagagctatggcagatctagaccatcctcatatcgttcggataacagatattggc
gaggaagacggtcaacagtacctagctatggagtatgtggctggactggacctcaaacgc
tatatcaaggaacattatcctctttctaatgaagaagcagtccgtatcatgggacaaatt
ctcttggctatgcgcttggcccatactcgaggaattgttcacagggacttgaaacctcaa
aatatccttttgacaccagatgggactgccaaggtcacagactttgggattgctgtagcc
tttgcagagacaagtctgacccagactaactcgatgttgggctcagttcattacttgtca
ccagagcaggcgcgtggttcgaaggcgactgtgcagagtgatatctatgccatggggatt
attttctatgagatgttgacaggccatatcccttatgacggggatagcgcggtgaccatt
gccctccagcatttccagaaacccctgccgtccgttattgcagaaaatccatctgtacct
caggctttagaaaatgttattatcaaggcaactgctaaaaagttgaccaatcgctaccgc
tcggtttcagagatgtatgtggacttgtctagtagcttgtcctacaatcgtagaaatgaa
agtaagttaatctttgatgaaacgagcaaggcagataccaagaccttgccgaaggtttct
cagagtaccttgacatctattcctaaggttcaagcgcagacagaacacaaatcaatcaaa
aacccaagtcaggctgtgacagaggaaacttaccaaccacaagcaccgaaaaaacataga
tttaagatgcgttacctgattttgttggccagccttgtattggtggcagcttctcttatt
tggatactatccagaactcctgcaaccattgccattccagatgtggcaggtcagacagtt
gcagaggccaaggcaacgctcaaaaaagccaattttgagattggtgaggagaagacagag
gctagtgaaaaggtggaagaagggcggattatccgtacagatcctggcgctggaactggt
cgaaaagaaggaaagaaaatcaatttggttgtctcatcaggcaaacaatccttccaaatt
agtaattatgtcggccggaaatcttctgatgttatcgcggaattaaaagagaaaaaagtt
ccagataatttgattaaaattgaggaagaagagtcgaatgagagtgaggctggaacggtc
ttgaagcaaagtctaccagaaggtacgacctatgacttgagcaaggcaactcaaattgtt
ttgacagtagctaaaaaagctacgacgattcaattagggaactatattggacggaactct
acagaagtaatctcagaacttaagcagaagaaggttcctgagaatttgattaagatagag
gaagaagagtccagcgaaagcgaaccaggaacgattatgaaacaaagtccaggtgccgga
acgacttatgatgtgagtaaacctactcaaattgtcttgacagtagctaaaaaagttaca
agtgttgccatgccgagttacattggttccagcttggagtttactaagaacaatttgatt
caaattgttgggattaaggaagctaatatagaagttgtagaagtgacgacagcgcctgca
ggtagtgcagaaggcatggttgttgaacaaagtcctagagcaggtgaaaaggtagacctc
aataagactagagtcaagatttcaatctacaaacctaaaacaacttcagctactccttaa

DBGET integrated database retrieval system