KEGG   Streptococcus pneumoniae ST556: MYY_1615Help
Entry
MYY_1615          CDS       T02087                                 

Definition
(GenBank) sialidase
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
snd  Streptococcus pneumoniae ST556
Pathway
snd00511  Other glycan degradation
snd00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:snd00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    MYY_1615
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    MYY_1615
Enzymes [BR:snd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     MYY_1615
Bacterial toxins [BR:snd02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   MYY_1615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sialidase BNR_2 Laminin_G_3 BNR_3 BNR Gram_pos_anchor Sortilin-Vps10
Motif
Other DBs
NCBI-ProteinID: AFC95272
LinkDB All DBs
Structure
PDB: 

Position
complement(1592336..1595212)
Genome map
AA seq 958 aa AA seqDB search
MIVGAVVFGTSPVLAQEGASEQPLANETQLSGGSSTLTDTEKSQPSEEGENITLPAEHVE
SVSETELSGNKQEQERKDKQEEKIPRDYYARDLENVETVIEKEDVETNASNGQRVDLSSE
LDKLKKLENATVHMEFKPDAKAPAFYNLFSVSSATKKDEYFTMAVYNNTATLEGRGSDGK
QFYNNYNDAPLKVKPGQWNSVTFTVEKPTAELPNGRVRLYVNGVLSRTSLKSGNFIKDMP
DVTHVQIGATKRANNTVWGSNLQIRNLTVYNRALTPEEVQKRSQLFKRSDLEKKLPEGAA
LTEKTDIFESGRNGKPNKDGIKSYRIPALLKTDKGTLIAGADERRLHSSDWGDIGMVIRR
SEDNGKTWGDRVTITNLRDNPKASDPSIGSPVNIDMVLVQDPETKRIFSIYDMFPEGKGI
FGMSSQKEEAYKKIDGKTYQILYREGEKGAYTIRENGTVYTPDGKATDYRVVVDPVKPAY
SDKGDLYKGNQLLGNIYFTTNKTSPFRIAKDSYLWMSYSDDDGKTWSAPQDITPMVKADW
MKFLGVGPGTGIVLRNGPHKGRILIPVYTTNNVSHLNGSQSSRVIYSDDHGKTWHAGEAV
NDNRQVDGQKIHSSTMNNRRAQNTESTVVQLNNGDVKLFMRGLTGDLQVATSKDGGVTWE
KDIKRYPQVKDVYVQMSAIHTMHNGKEYIILSNAGGPNRENGMVHLARVEENGELTWLKH
NPIQKGEFAYNSLQELGNGEYGILYEHTEKGQNAYTLSFRKFNWEFLSKDLIFPTEAKVK
RTREMGKGEMGKGVIGLEFDSEVLVNKAPTLQLANGKTATFLTQYDSKTLLFAVDKEDIG
QEIIGIAKGSIESMHNLPVNLAGARVPGGVNGSKAAVHEVPEFTGGVNGTEPAVHEIAEY
KGSDSLVTLTTKEDYTYKAPLAQQALPETGNKESDLLASLGLTAFFLGLFTLGKKREQ
NT seq 2877 nt NT seq  +upstreamnt  +downstreamnt
atgattgtaggagcagtggtatttggaacgtctcctgttttagctcaagaaggggcaagt
gagcaacctctggcaaatgaaactcaactttcggggggaagctcaaccctaactgataca
gaaaagagccagccttctgaggaaggagaaaatataactcttcctgcagagcatgtagag
tctgtttcagagactgaactttctggcaataagcaagaacaagaaaggaaagataagcaa
gaagaaaaaattccaagagattactatgcacgagatttggaaaatgtcgaaacagtgata
gaaaaagaagatgttgaaaccaatgcttcaaatggtcagagagttgatttatcaagtgaa
ctagataaactaaagaaacttgaaaacgcaacagttcacatggagtttaagccagatgcc
aaggccccagcattctataatctcttttctgtgtcaagtgctactaaaaaagatgagtac
ttcactatggcagtttacaataatactgctactctagaggggcgtggttcggatgggaaa
cagttttacaataattacaacgatgcacccttaaaagttaaaccaggtcagtggaattct
gtgactttcacagttgaaaaaccgacagcagaattgccaaatggtcgagttcgcctgtat
gttaatggtgttttatctcgaacaagtctgaaatctggcaatttcattaaagatatgcca
gatgtaacgcatgtgcaaatcggagcaaccaagcgtgccaacaatacggtttgggggtca
aatctacagattcggaatctcactgtgtataatcgtgctttaacaccagaagaggtacaa
aaacgtagtcaactttttaaacgctcagatttagaaaaaaaactacctgaaggagcggct
ttaacagagaaaacggacatattcgaaagcgggcgtaacggtaaaccaaataaagatgga
atcaagagttatcgtattccagcacttctcaagacagataaaggaactttgatcgcaggt
gcagatgaacgccgtctccattcgagtgactggggtgatatcggtatggtcatcagacgt
agtgaagataatggtaaaacttggggtgaccgagtaaccattaccaacttacgtgacaat
ccaaaagcttctgacccatcgatcggttcaccagtgaatatcgatatggtgttggttcaa
gatcctgaaaccaaacgaatcttttctatctatgacatgttcccagaagggaagggaatc
tttggaatgtcttcacaaaaagaagaagcctacaaaaaaatcgatggaaaaacctatcaa
atcctctatcgtgaaggagaaaagggagcttataccattcgagaaaatggtactgtctat
acaccagatggtaaggcgacagactatcgcgttgttgtagatcctgttaaaccagcctat
agcgacaagggtgatctatacaagggtaaccaattactaggcaatatctacttcacaaca
aacaaaacttctccatttagaattgccaaggatagctatctatggatgtcctacagtgat
gacgacgggaagacatggtcagcgcctcaagatattactccgatggtcaaagccgattgg
atgaaattcttgggtgtaggtcctggaacaggaattgtacttcggaatgggcctcacaag
ggacggattttgataccggtttatacgactaataatgtatctcacttaaatggctcgcaa
tcttctcgtgtcatctattcagatgatcatggaaaaacttggcatgctggagaagcggtc
aacgataaccgtcaggtagacggtcaaaagatccactcttctacgatgaacaatagacgt
gcgcaaaatacagaatcaacggtggtacaactaaacaatggagatgttaaactctttatg
cgtggtttgactggagatcttcaggttgctacaagtaaagacggaggagtgacttgggag
aaggatatcaaacgttatccacaggttaaagatgtctatgttcaaatgtctgctatccat
acgatgcataatggaaaagaatacattatcctcagcaatgcaggtggaccgaatcgtgaa
aatgggatggtccacttggcacgtgtcgaagaaaatggtgagttgacttggctcaaacac
aatccaattcaaaaaggagagtttgcctataattcgctccaagaattaggaaatggggag
tatggcatcttgtatgaacatactgaaaaaggacaaaatgcctataccctatcatttaga
aaatttaattgggaatttttgagcaaagatctgatttttcctaccgaagcgaaagtgaag
cgaactagagagatgggcaaaggagagatgggcaaaggagttattggcttggagttcgac
tcagaagtattggtcaacaaggctccaacccttcaattggcaaatggtaaaacagcgact
ttcctaacccagtatgatagcaagaccttgttgtttgcagtagataaggaagatatcgga
caggaaattattggtatagctaaaggaagcatcgaaagtatgcataatcttcctgtaaat
ctagcaggtgccagagttcctggcggagtaaatggtagcaaagcagcggtgcatgaagtt
ccagaatttacagggggagttaatggtacagagccagctgttcatgaaatcgcagagtat
aagggatctgattcgcttgtaactcttactacaaaagaagattatacttacaaagctcct
cttgctcagcaggcacttcctgaaacaggaaacaaggagagtgacctcctagcttcacta
ggactaacagctttcttccttggtctgtttacgctagggaaaaagagagaacaataa

DBGET integrated database retrieval system