KEGG   Simkania negevensis: SNE_A03880Help
Entry
SNE_A03880        CDS       T01559                                 

Definition
(GenBank) hypothetical protein
Organism
sng  Simkania negevensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HOOK CENP-F_leu_zip
Motif
Other DBs
NCBI-ProteinID: CCB88265
UniProt: F8L6D5
LinkDB All DBs
Position
gsn.131:complement(382275..387026)
Genome map
AA seq 1583 aa AA seqDB search
MTIISREPTLLSSDIAVDSKPLKLQSMNQSAYQSYHRSISPDVAKLMKTSHFQEKVREVI
PRRDFALSTNVQVRVKENGTVLIREKDGDAWLKIYNKSETESPELDEPIDEIVRKTREAY
NGLFPHSEEKDTKPLTSERISSSSPPCHHCCGHHHSPDSLQSRDELIRDLRDEVRELRRE
IERLKETDSRPPVTKVVELEHGLRSTKSRIETLPNMEPTLLAQNKELRRQKGEIDDLRED
LTQANQHKAALLLLLSAASECNKSLQSQLQTTAEDLGITEETLGTVMDELDRLQREKGVV
ENTLQERTEQLSKMLALFLGTAALYQQSQLRIANLQDKASRLGEDNEALEQNLEKRTKEL
QGAVLLLALASGLHEQNQHQLQTLRELHGKVSEERNSLAHQLELAQQEVERLSKVELPEA
HEAKQRLEKELKEAKQQVEDLTPKLKAETEKVAELEDLLHGKDEELQIAKEATQSIQRKL
DEAHESHARELKDLREEFGSAKKQLTSEHEEQVRKLTSSHAEDLEQKLRDQKLKFDEESR
RLTETYQEKERKLTEQHGLQVHQLEEQVKDLGSKLEAATKRAEKAERLLEEKGSELSLAR
KDFEKQLRLKDEEVRLAKEATQDVQRKLDEAHESHERNLEQVREEFESAKKRLISENEEQ
VRKLTSSHVEDLEQKLRDQKQKFDEESRRLTETYQEKERKLTEQHGLQVHQLEEQVKDLG
SKLEAATKRAEEAERLLKEKGSELSLARKDFEEQLRLKSEEVRLAKVATEDVQQELEKAH
ETHKRELERLREAFTSDKRELSRREEELTQRYDLQVRELETKLQKQKESFEQAFTKLDES
YRRSEAHLKEEFGLALRALGVEKKDAEARAEELQERVKELEEILREAHDKVSKLPISIAE
DSDPSSFPGKYIVGKIKDLLDENQRLNLEMSELKKEQLQVRESHGIELKELDEKHRQELK
KLAKEHQSKIQAIQSEIEGYTSEIDRLRKKVSGLISAQLHDKQKIKQLEDINHELREELF
KTDQRDISQKSTIDTLKSKISRIEKESTEKDQALEEANSDILKRRAEIEELKRSMKQRDK
EIQEAGEELSGMTEDRDYLQGELLKEKKKVRLAEEMLLSTEERASRLEQELNEKKQAYDR
LKEETEIALANMEREARKSSSEYENHILELTSALKEKSQKVLELEEENRILRERVETQDK
ELEELQKEVKLLRKENRELWSILERLATILNVTFNRDNLKTTGQSILEGIKTSAFAKGAL
GEIAAQIGLNENAEMPAIHKRLEELIQIEGQFDLLHKEKQRALEELEAISRSIEVTKPLC
DMSVSASSSELSGIQQAFQEITSAIMHLTHGLGKEQVYLSGLNSQQEEVLRYNRNAILNP
NSILHLEKQVTSIVSKAKGKAESSNHKGFNAIIYDKNNLLDFIDRIHGFFEKNNKHFRKI
DAYQTQLKALIERAKSISEQGLTMKTSDLRELQATIKSIHALKKERQVLIQSLVIALIDA
IRFDSIATKNRYTGQLATGSGFPMFGKDLMAYFQAFQKLDPSYYIDGKPTNPLIDDCHKA
EEFRMLVTSLQGSLGALFAKITI
NT seq 4752 nt NT seq  +upstreamnt  +downstreamnt
atgacaatcatcagcagagaaccaactcttctgtcatctgatatagccgttgattctaag
ccacttaaacttcaaagcatgaatcaaagcgcctatcagagctaccaccgtagcatctct
ccggatgtcgctaagctgatgaaaaccagtcatttccaagaaaaagtccgagaagtcatt
ccaaggcgtgattttgccctttcgacaaacgtccaagtccgtgtgaaggaaaatggtacc
gtcttgattcgagaaaaagacggggacgcatggctcaaaatttacaataaatctgaaacc
gaatcgccagagctagacgagcccattgacgaaatcgtccgaaagacccgagaggcctac
aatggtcttttcccccattccgaagaaaaagacaccaagcccctcactagtgaaaggatc
tcaagctcatctccaccctgccatcactgctgtggccaccaccattctccagacagctta
cagtcacgcgatgaattgattcgcgacctacgcgacgaagtgcgtgaacttcgacgtgaa
attgagcgtctaaaagaaaccgactctcgccctccagtgaccaaagtagtcgagcttgaa
catggactgcgctcaacaaaaagtcgcatcgagaccctgccgaatatggaacccactctc
cttgcgcaaaataaagagcttcgtcgacaaaaaggcgaaatcgacgatttgcgcgaagac
ctcactcaagcaaaccaacataaagctgctctcttattacttctctcagcagcaagtgag
tgcaacaaatcattgcaaagtcaattgcaaacaacagccgaagatttagggatcactgaa
gaaacactgggaacagtgatggatgagctcgacaggttacaaagagaaaaaggcgtcgtc
gaaaacacactccaagagcgcacagaacagcttagcaaaatgctggcactttttctcgga
acagctgctctctatcaacaatctcaattaagaatcgcaaatcttcaggacaaggcttca
cgattaggtgaagacaatgaagcacttgagcaaaaccttgaaaagcggacaaaagagctc
cagggagcagttcttctcctagctcttgcaagcgggctgcatgagcagaatcaacatcag
ctgcaaacactacgcgaacttcatggaaaggtttcagaggaaagaaatagcttagcccat
caacttgagttagctcagcaagaggttgaaaggctctcaaaagttgaacttcccgaagca
catgaagctaagcaacgtttggaaaaggaattaaaagaagcaaagcagcaagttgaagat
cttaccccaaaactcaaagcagaaacagaaaaagttgccgaactagaagatctcttacac
ggtaaagatgaagaattgcaaattgctaaagaagcaactcaaagtattcaacgaaaatta
gacgaagctcacgagtcacacgcaagagagcttaaggatctcagagaagaatttggatct
gcaaagaaacaactgacatcagagcacgaagaacaagttcgaaagctaacatcttctcat
gctgaagacctcgagcaaaaacttcgtgaccaaaagctaaaatttgatgaagagtcaaga
cgccttactgagacatatcaagagaaagaaagaaaactcacagagcaacatggactccaa
gttcatcagctagaagaacaagttaaagacctcggctcaaagcttgaagctgcaacaaaa
cgtgctgaaaaagccgaaaggcttctcgaagagaaaggatcagagctcagcttagctaga
aaagactttgaaaagcaattacgtcttaaagatgaagaagttcgcttagcaaaagaagca
actcaagatgttcaacgaaaattagacgaagctcatgagtcacacgaaagaaacctagag
caagtcagagaagaatttgaatctgcaaagaaacgactgatatcggagaacgaagaacaa
gttcgaaagctaacatcctctcatgttgaagacctcgagcaaaaacttcgtgaccaaaag
caaaaatttgatgaagagtcaagacgccttactgagacatatcaagagaaagaaagaaaa
ctcacagagcaacatggactccaagttcatcagctagaagaacaagttaaagacctcggc
tcaaaacttgaagctgcaacaaaacgtgctgaagaagctgaaagactacttaaggagaag
ggatcagagctcagcttagctagaaaagactttgaagagcaattacgtcttaaaagtgaa
gaagttcgcttagcaaaagtagcaactgaagatgttcaacaggaattagagaaggctcac
gagactcacaaaagagaactagaacgacttagagaagcctttacttcggataaaagagaa
ctgtcacgacgagaagaagaactcactcagcgctatgaccttcaagttcgtgaacttgaa
acaaaacttcaaaagcaaaaagaatcttttgaacaggcttttactaagcttgacgaaagt
taccgaagatctgaagcacaccttaaggaagaattcgggctcgcactccgagctttgggg
gttgagaaaaaagatgccgaagctagagctgaagaattacaagaaagagttaaagagcta
gaagagattctaagagaggctcatgacaaagtttcaaagttacccatttctattgcagaa
gatagcgacccatcttccttccctggaaaatacattgtcggaaaaatcaaggatctcttg
gatgaaaatcagcgccttaatttggagatgagcgagttaaaaaaggagcaactccaagtt
cgagaaagtcacggaatcgaacttaaagaactagatgaaaaacatcgacaggaactcaag
aagctcgctaaagaacatcaaagcaaaatccaagcaatccaatccgaaatcgaaggatac
acctcagaaatcgaccgcttgcgcaaaaaggtgagtggactcatctcagcacaattacat
gataaacaaaagattaaacaattagaagacatcaatcacgagcttcgagaagaactcttt
aaaacggatcaacgtgacatatcccaaaaaagcaccatcgatactttaaaatcaaaaatc
tcaagaattgagaaagagtctacagaaaaagaccaagctctcgaagaagctaattcagat
atcttgaaaagacgagctgaaattgaagaattaaagcgatcaatgaagcaacgtgataaa
gagattcaagaggcaggtgaagagctttcgggaatgacagaagatcgcgattaccttcaa
ggtgaattgcttaaagaaaaaaagaaagttcgtcttgctgaagaaatgctcctttcaact
gaagaaagggcctctcgacttgagcaagaacttaatgaaaagaaacaagcatacgataga
ctcaaagaagaaactgaaatcgctctcgctaatatggaacgcgaagcaagaaaaagtagc
tcagaatatgagaaccatattttggagcttacaagcgctctaaaagaaaaatcgcaaaaa
gtcttagagcttgaagaagaaaaccgcattttacgcgaaagagttgaaacgcaagacaaa
gagcttgaggagctacagaaagaagtcaaacttttgcgcaaagaaaatcgcgaactctgg
agcattctagagcgcctcgcaaccattctcaacgtcacatttaatcgagacaatttaaaa
acaactgggcaatcaatcttagaagggatcaaaacctccgcgtttgcaaagggagctctt
ggagaaattgcagctcagatcggattaaacgaaaacgctgagatgcctgcaattcacaag
cgtcttgaagaattgattcaaatcgaagggcaatttgatctacttcataaagaaaaacaa
cgtgcattggaagaactagaggcaatctcaagaagtattgaagttacaaagcctttatgt
gatatgagcgtaagtgcaagctcttcagaactatctgggattcagcaagcctttcaagaa
atcacgtctgcaattatgcatcttactcatggacttggaaaagaacaggtttatttaagt
ggattaaattcacaacaagaagaagttttgcgctataatagaaacgctatacttaatcct
aatagcattcttcatttagagaaacaagtcacctcgattgtttcaaaagctaaaggtaaa
gccgagagttcaaaccataaagggttcaatgccatcatctatgataagaataatctgctc
gatttcatcgatcggattcatggctttttcgaaaaaaacaacaaacatttccgaaaaatt
gatgcttatcaaactcaattaaaagcattaattgaaagagccaagtcgattagcgagcaa
ggccttaccatgaaaacaagcgaccttcgagaattgcaagcaacgatcaaatcgatccat
gcgctaaagaaagaacgacaagtgttaattcaaagcttggtgattgcactcatcgatgcg
attaggtttgattcaatcgcaacaaaaaaccgttatacaggtcaacttgcgactggatct
ggatttccaatgtttggaaaagatcttatggcctatttccaagcttttcaaaaacttgat
cctagctattacatagatggcaaacccacaaaccctcttattgacgattgccataaagct
gaagaatttcgaatgctcgtaacctctcttcaaggaagtttaggggcccttttcgcaaaa
attacgatttag

DBGET integrated database retrieval system