KEGG   Simkania negevensis: SNE_A08910Help
Entry
SNE_A08910        CDS       T01559                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sng  Simkania negevensis
Pathway
sng00010  Glycolysis / Gluconeogenesis
sng00051  Fructose and mannose metabolism
sng00562  Inositol phosphate metabolism
sng01100  Metabolic pathways
sng01110  Biosynthesis of secondary metabolites
sng01120  Microbial metabolism in diverse environments
sng01130  Biosynthesis of antibiotics
sng01200  Carbon metabolism
sng01230  Biosynthesis of amino acids
Module
sng_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sng00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SNE_A08910 (tpiA)
   00051 Fructose and mannose metabolism
    SNE_A08910 (tpiA)
   00562 Inositol phosphate metabolism
    SNE_A08910 (tpiA)
Enzymes [BR:sng01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SNE_A08910 (tpiA)
Exosome [BR:sng04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SNE_A08910 (tpiA)
  Exosomal proteins of bladder cancer cells
   SNE_A08910 (tpiA)
  Exosomal proteins of melanoma cells
   SNE_A08910 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM NfI_DNAbd_pre-N
Motif
Other DBs
NCBI-ProteinID: CCB88768
UniProt: F8L7N4
LinkDB All DBs
Position
gsn.131:928123..928890
Genome map
AA seq 255 aa AA seqDB search
MKRRIIIAGNWKMHMSAAETRAFVEQLLPQVKGVSSSVYLAPPFTSIQAATDAALGSAVC
IGAQNMSQYHKGAYTGEVSSMMLKEAGASFVILGHSERRHIFKEDNEMIHSKLKWALEEK
IEPILCIGETQEERDQNRTKEVLETQLGEALKDFSPEEVRKMILAYEPVWAIGTGKTATP
EIAQEAHLLCRSFVAEKCGKEAAEVVPILYGGSVKPENIGELIQKPDIDGALIGGASLEV
DSFAQIIHNVEETLK
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgaagaattattattgctgggaactggaagatgcacatgtctgcagccgaaacg
cgtgcatttgtcgagcagcttttgccacaggttaaaggtgtctcatcgagtgtttatctc
gcgccaccattcacatcgatccaggctgcgacggatgctgcgctaggaagcgcagtgtgc
attggggcgcaaaacatgagccagtaccataaaggggcttacacaggagaagtttcctcc
atgatgctaaaagaagcaggagcttcttttgtgattctcggtcactcagaacgacgccac
atttttaaagaagataatgaaatgatccactccaagcttaaatgggccttagaagaaaaa
atcgagcccattctttgcattggtgaaactcaagaagagcgagatcaaaacaggacgaaa
gaggtcttagaaactcaactgggagaagccctaaaagacttttctcccgaagaggtccga
aaaatgattttggcatatgaacctgtctgggcaattgggacagggaaaactgctacacct
gagattgctcaagaggcccacctcctttgtcgcagctttgttgctgaaaagtgtggcaaa
gaagcggcggaagttgtaccgattctctatggaggttcagtcaaaccagagaatattgga
gagcttattcaaaagcccgatatcgatggcgctttaatcggaggagcctcgctcgaagtt
gattcctttgctcaaatcattcacaacgttgaggaaaccttaaaatga

DBGET integrated database retrieval system