KEGG   Simkania negevensis: SNE_A09900Help
Entry
SNE_A09900        CDS       T01559                                 

Gene name
chrC
Definition
(GenBank) superoxide dismutase [Fe]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
sng  Simkania negevensis
Brite
Enzymes [BR:sng01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SNE_A09900 (chrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: CCB88867
UniProt: F8L7W5
LinkDB All DBs
Position
gsn.131:1019114..1019839
Genome map
AA seq 241 aa AA seqDB search
MIDFALGVLMLKKYFIFLFPAFSLFAKTPTYDPQIIPQTTAPINIEAKDFSHLLGHLKGI
DDDLLKMHFTLYNGYVKNASALLTTLVQMRQNGKDTTLEYGAIERRFVWEFDGMILHELY
FENLGPKPFLDRKDPLLLKMTMDFGSFEQWKKNFVATGLIKGVGWVILYQSPKTGHLNNI
WVDEHNINLVPGGKPLLIMDVWEHAYITEYGLDRAGYIEAFMQNIDWEVVSKRFNDMESS
K
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
ttgattgactttgcgttaggtgttctcatgttgaaaaaatattttatctttctctttcct
gctttttcactttttgcaaaaactccgacgtatgatccgcagattattcctcaaaccaca
gcccctattaacattgaagctaaggacttttcccatcttttaggacatttaaaaggaatt
gatgatgacctattgaagatgcattttaccctttacaacgggtatgtcaaaaatgctagc
gcccttctcacgactttagttcaaatgcggcaaaacgggaaggatacaaccttggaatat
ggagcaatagagcggcgctttgtgtgggaatttgatggaatgattcttcatgaactctac
tttgagaatttggggccgaagccctttttagatcgaaaagatcctttgttgttgaaaatg
acgatggattttggaagctttgaacaatggaaaaagaactttgtagcaacaggcctcatt
aaaggtgtcggttgggtcattctctatcaaagcccgaagacaggacacttaaataatatc
tgggtagatgagcacaatatcaacctcgttcctggagggaaacctctccttattatggat
gtctgggagcatgcctacatcactgaatatgggctcgaccgggctggatatattgaggct
tttatgcaaaacattgactgggaagtcgtttctaaacgatttaacgatatggaatcaagc
aagtaa

DBGET integrated database retrieval system