KEGG   Simkania negevensis: SNE_A13560Help
Entry
SNE_A13560        CDS       T01559                                 

Gene name
gPD2
Definition
(GenBank) glycerol-3-phosphate dehydrogenase,mitochondrial
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sng  Simkania negevensis
Pathway
sng00564  Glycerophospholipid metabolism
sng01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sng00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SNE_A13560 (gPD2)
Enzymes [BR:sng01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SNE_A13560 (gPD2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 GIDA HI0933_like Pyr_redox_3 Pyr_redox_2 Lycopene_cycl NAD_binding_8 Thi4
Motif
Other DBs
NCBI-ProteinID: CCB89233
UniProt: F8L8U0
LinkDB All DBs
Position
gsn.131:1414097..1415650
Genome map
AA seq 517 aa AA seqDB search
MKREDMLRNLREDQWDVIIIGGGATGLGAAVDAASRGFHTLLVEQHDFAKATSSRSTKLI
HGGLRYLQQGNIALVLEALRERGRLCQNAPHLIYHRAFFVPSYKWWEGPFYGIGLKIYDM
LAGKLGLEASKHLSREETLGALPNLEPEGLRGGTLYYDGQFDDSRLAFTLAQTAADHGAT
VLNYMKVTSLIKDKNHLKGVVVEDQETKEKKELYAKVIINATGVFSDDIRHMDKPEVPSI
IQPSQGIHIVLEKHFLESETAILVPHTDDGRVLFMVPWHDRILVGTTDTLVKEKSLEPKP
LEDEIEFVLKHAGKYLAKRPKRSDILSVFAGLRPLIAHQGKKTAALSRDHSIIVSETGLV
TVAGGKWTTYRKMAEDVIDKAIVVGSLTECPCRTKTLQLHGWLDQVDPSDPWSAYGSDRK
NIEKVLNEDPSYRELLSNRLPYMKGEVIWAVREEMARTVEDVLARRTRSLLIDARIAMAV
APLVASLIAKEREMPKSWEESQVKEFKELANIYLPQR
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgggaagacatgctcagaaacctacgagaagatcagtgggatgtgatcatcatc
ggtggtggagccacaggcctgggagcagcagtggatgccgcttctcggggtttccacact
cttttagtcgaacaacacgactttgccaaggccacttcttcgcgtagcaccaaactcatt
catggaggcctccgttacttgcagcaaggaaacatcgcacttgtgctcgaagcattgaga
gaaagagggcgtctttgtcaaaacgcaccccacctcatttatcaccgcgcctttttcgtt
ccgagctacaaatggtgggaaggtcctttctatgggattgggctgaaaatttacgacatg
cttgcaggaaaacttggacttgaagcctctaaacacctatcccgcgaagaaactttaggg
gcacttcctaaccttgaacccgaaggactccgcggaggaactctttactatgatgggcaa
tttgatgattctcgtcttgctttcaccttagctcaaactgccgctgatcatggcgctacc
gttttaaactacatgaaagtcacaagcttgataaaagataaaaaccatctcaagggtgtt
gtcgttgaagatcaagaaacaaaagaaaagaaagaactctacgctaaagtgatcatcaat
gcaacgggggttttttccgatgatatccggcacatggacaaacccgaggttccatctatt
atccaacctagccaaggcattcatatcgttttagaaaaacactttctcgaaagtgaaacc
gcaattttggtgcctcatacagacgatggaagagttctcttcatggttccctggcatgac
cgcattctcgtcggtacaaccgacacacttgttaaagaaaagagcttggaacccaaacct
ctagaagatgaaatcgaatttgttctcaaacacgctggaaaatacctggcaaagaggcca
aaacgctctgacattctcagcgtctttgcaggattgcgcccccttatcgcccaccaagga
aaaaagacagccgctctctctcgggatcactcgatcattgtttcagagacaggccttgtg
accgtcgcagggggaaaatggaccacctatcgaaaaatggcagaagatgtcatcgacaaa
gccattgtggtcggtagtttaaccgagtgtccttgccgtaccaaaacacttcaattgcac
ggatggctcgatcaagttgacccttctgatccttggagcgcatacggatctgacagaaaa
aacatcgaaaaagtactcaatgaagacccttcctatagagagctccttagcaatcgcctc
ccctacatgaaaggggaagtcatttgggctgtgcgcgaagaaatggcgcgcaccgtcgaa
gatgttctcgcgcgccgcacaagaagcctccttatcgatgcccgaatcgccatggccgtt
gccccactagttgccagtctaattgccaaagagcgggaaatgcccaaatcatgggaagaa
agccaagttaaagaattcaaagagcttgcaaatatttatcttccccaaagataa

DBGET integrated database retrieval system