KEGG   Streptococcus pneumoniae INV104: INV104_08820Help
Entry
INV104_08820      CDS       T02072                                 

Gene name
tdk
Definition
(GenBank) putative thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
sni  Streptococcus pneumoniae INV104
Pathway
sni00240  Pyrimidine metabolism
sni01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sni00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    INV104_08820 (tdk)
Enzymes [BR:sni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     INV104_08820 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK KdpD
Motif
Other DBs
NCBI-ProteinID: CBW36565
LinkDB All DBs
Position
974568..975158
Genome map
AA seq 196 aa AA seqDB search
MAQLYYRYGTMNSGKTIEILKVAYNYEEQGKGVVIMTSALDTRDGVGYVSSRIGMKRPAL
AIEETTDIFGYIRGLPEKPYCVLVDEAQFLKRHHVYDLARVVDELDIPVMAFGLKNDFRN
ELFEGSKYLLLLADKIDEIKTICQYCKKKATMVLRTQDGLPVYDGEQIQIGGNETYISVC
RKHYFAPEINKENEEK
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggcacagttgtattatcgttatgggaccatgaactctggaaagacaatcgagattctc
aaggtggcctataactatgaggagcaaggaaaaggtgttgtgattatgacttcagctctg
gatacgcgtgacggtgttggctatgtgtcgagtcgaattggcatgaaacgccctgccctt
gcgattgaggaaacaacggatatctttggctatatccgaggcctaccagaaaaaccttac
tgtgtgttggtcgatgaagcccagtttctcaaacgccaccatgtttatgacctagctcgt
gttgtggacgagttagacatacccgtcatggcttttggcttgaaaaatgactttcgcaat
gaattgttcgaaggttccaaatatctcttgcttttagcagacaagattgacgaaatcaag
accatctgtcagtattgcaagaaaaaggcgaccatggtgttgcgaacacaggatggactg
cccgtttacgatggagaacagatccaaattggtggtaatgaaacctatatctcggtttgc
cgtaaacattattttgcccctgaaatcaataaggagaatgaagaaaaatga

DBGET integrated database retrieval system