KEGG   Sphingomonas sp. NIC1: A7E77_06665Help
Entry
A7E77_06665       CDS       T04479                                 

Definition
(GenBank) hydrolase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
snj  Sphingomonas sp. NIC1
Pathway
snj00361  Chlorocyclohexane and chlorobenzene degradation
snj00625  Chloroalkane and chloroalkene degradation
snj01100  Metabolic pathways
snj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:snj00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    A7E77_06665
   00361 Chlorocyclohexane and chlorobenzene degradation
    A7E77_06665
Enzymes [BR:snj01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     A7E77_06665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: ANC86601
LinkDB All DBs
Position
complement(1372333..1372974)
Genome map
AA seq 213 aa AA seqDB search
MSVAPADVEPAVTPTAVIFDIGRVLYDWDPRILYRRLIDDDRALDAFLRDVVTHEWHFQH
DAGRDFAETSAELIALYPQHADLIAAWGPRFLESIGDPMPGMPALVDELEAAGVPLFGIT
NFSHEFWPPFRARESAMFDRFRDIVVSGAEKMVKPDPAIYRLALARFGLEAGRTVFIDDN
AANVAGAQSVGLIALHFEGEPKLRRELQALGVL
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgtggctccagccgatgtcgagcctgccgtcacaccgacggcggtcatcttcgat
atcggccgggtcttgtacgactgggatccccggatcctctaccggcgcctgatcgacgac
gatcgggcgctcgatgcgttcctgcgcgacgtcgtcacgcacgaatggcatttccagcat
gacgctgggcgcgacttcgccgagacctcggcggagcttatcgcgctgtatccgcagcat
gccgatctgatcgccgcttgggggccgcggttcctggagagcatcggcgatcccatgccg
ggcatgcccgcgctggtcgacgaactggaggcggccggcgtgccgctgttcggcatcacc
aacttcagccacgaattctggccgccgttccgcgcgcgcgaatcggcgatgttcgatcgc
ttccgcgacatcgtggtgtcgggcgcggagaagatggtgaagccggatccggcgatttac
cggctggcgctggcgcggttcgggctggaggcgggccgcacggtgttcatcgacgacaat
gccgcgaacgtcgcgggggcgcagagcgtcgggctgatcgcgctgcatttcgaaggtgag
ccgaagctgcggcgggagctgcaggcgttgggggtgctgtaa

DBGET integrated database retrieval system