KEGG   Sphingomonas sp. NIC1: A7E77_11185Help
Entry
A7E77_11185       CDS       T04479                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
snj  Sphingomonas sp. NIC1
Brite
KEGG Orthology (KO) [BR:snj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    A7E77_11185
Enzymes [BR:snj01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     A7E77_11185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored HI0933_like FAD_binding_3 DAO K_oxygenase Glutaredoxin Thi4 NAD_binding_7 AlaDh_PNT_C NAD_binding_8 FMO-like
Motif
Other DBs
NCBI-ProteinID: ANC87413
LinkDB All DBs
Position
complement(2341299..2342885)
Genome map
AA seq 528 aa AA seqDB search
MLDSNLTQQLKAYLVHVRFPVELVASLGQDAKSQQMRELLDEIAALSDKVSVTTSDDDRT
PSFLIRRAGTDIGVRFAGLPMGHEFTSLVLALLQVGGHPSKAAQDLIEQVVALDGDYHFE
TYFSLSCANCPDVVQALNLMAVLNPRVTHTAIDGALFQDEVASRKVMAVPTVFLNGEPFG
QGRMELEQIVAKLDTGASARAAEKIGAKDAFDVLVVGGGPAGAAAAIYTARKGIRTGIAA
ERFGGQVLDTMGIENFISVPHTEGPKLAAELERHVRDYDVDIMNLQRAEKLVPAGADGLH
EVVLENGASLKARTVILSTGARWRTMNVPGEAEYRNKGVAYCPHCDGPLFKRKRVAVIGG
GNSGVEAAIDLAGIVAHVTLIEYDSELRADAVLQRKLRSLANVTVLTSALTTEVHGDGDK
VVALSYRDRNNEAVHRVDLAGIFVQIGLVPNTEWLAGAVALSPHGEIEIDHRGHTSQPGI
FAAGDVTTVPYKQIVIAMGEGSKAALSAFDHLIRMPVEETRDWEEAAE
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgctcgactccaatctgacgcagcagctcaaagcctatctggtccacgtccgcttcccc
gtggagctggtcgcgagcctggggcaggacgccaagtcgcagcagatgcgcgagctgctc
gacgagatcgccgcgctgtcggacaaggtcagcgtcaccactagcgatgacgaccgcacg
cccagcttcctgatccgccgcgccggcacggacatcggcgtccgcttcgccggcctgccg
atgggccacgaattcacctcgctcgtgctcgcgctgctccaggtcggcggccacccgtcg
aaggcggcgcaggacctgatcgagcaggtcgtggcgctcgacggcgactatcatttcgaa
acctatttctcgctgtcctgcgccaattgccccgacgtcgtgcaagcgctgaacctgatg
gcggtcctcaacccgcgcgtgacgcacaccgcgatcgatggcgcgctgttccaggacgag
gtcgccagccgcaaggtgatggcggtgccgaccgtattcctgaacggcgaacccttcggc
cagggccggatggaactggaacagatcgtcgccaagctcgacaccggcgcctccgcgcgc
gcggccgaaaaaatcggagccaaggacgcgttcgacgtcctcgtcgtcggtggcggcccc
gctggtgccgccgcggcgatctataccgcgcgcaagggcatccgcaccggcatcgcggcg
gaacgcttcggcgggcaggtgctcgacacgatgggaatcgaaaatttcatctcggtgccg
cataccgaaggtccgaagctcgccgccgagctggaacgccatgtgcgcgactatgacgtc
gacatcatgaacctgcagcgcgcggaaaagctggtgccggcgggcgccgacggcctgcac
gaagtcgtgctggaaaacggcgcgtcgctcaaggcgcgcaccgtcatcctgtcgaccggc
gcgcgctggcgcacgatgaacgtgccgggcgaggcggaataccgcaacaagggtgtcgcc
tattgcccgcattgcgacggcccgctcttcaagcgcaagcgcgtcgcggtgatcggcggc
ggcaactcgggcgtcgaagcggcgatcgacctcgccggcatcgtcgcgcacgtcacgctg
atcgaatatgacagcgaattgcgcgccgacgcggtgttgcagcgcaagctgcgcagcctc
gccaacgtcaccgtccttacctctgcgctgaccacggaagtccatggcgacggcgacaag
gtcgtcgctctgtcctaccgcgatcggaataacgaggcggtgcatcgggtcgatctcgcc
ggtatcttcgtacagatcggcctcgtccccaataccgagtggctggcgggagccgtcgcg
ctgtcgccgcacggcgagatcgaaatcgaccaccgcggccacacttcgcagcccggcatc
ttcgcggccggcgacgtgacgaccgtgccgtacaagcagatcgtgatcgcgatgggcgaa
gggtcgaaggcggcgctgtcggccttcgatcacctgatccgcatgccggtggaagaaacg
cgcgactgggaagaagcggcggagtaa

DBGET integrated database retrieval system