Streptomyces nitrosporeus: CP967_23925 Help Entry CP967_23925       CDS       T06889                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism snk  Streptomyces nitrosporeus Pathway snk00998   Biosynthesis of various antibiotics snk01100   Metabolic pathways snk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:snk00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CP967_23925   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CP967_23925 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF1493 Motif Other DBs NCBI-ProteinID:  QEU74634 UniProt:  A0A5J6FGK5 LinkDB All DBs Position complement(5411856..5412104) Genome browser AA seq 82 aa AA seqDB search MAATQKEILDGLAEIVNEIAGIPVEDVELEKSFTDDLDVDSLSMVEVVVAAEERFEVKIP DEDVKNLKTVGDATDYILKHQS NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccgccacgcagaaggagatcctcgacggtctcgccgagatcgtcaacgagatcgcc ggtatcccggtcgaggacgtcgaactggagaagtccttcaccgacgacctggacgtcgac tcgctgtccatggtcgaggtcgtcgtcgccgccgaggagcgcttcgaagtgaagatcccc gacgaggacgtcaagaacctcaagacggtcggcgacgccaccgactacatcctgaagcac cagagctga

DBGET integrated database retrieval system