KEGG   Staphylococcus nepalensis: BJD96_00740Help
Entry
BJD96_00740       CDS       T05272                                 

Definition
(GenBank) hydroxyacid dehydrogenase
Organism
snl  Staphylococcus nepalensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 AdoHcyase_NAD IlvN F420_oxidored NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: ATH58970
UniProt: A0A291JHC6
LinkDB All DBs
Position
complement(162808..163761)
Genome map
AA seq 317 aa AA seqDB search
MKKVFIAGAIPEMGLSQLEKHFEVDMYTGKTLISEALLIQKVQDADALITLLSTNVSRKV
IESAPKLKIIANYGAGFNNIDIQAARERHIDVTNTPIASTNATADLTMGVLLAVARRIPE
GDQLCRNEGFNGWSPLFFRGREVSGKTIGIIGLGEIGMAVARRAKGFDMSVLYTGPNRYK
DKEAELNAEYVTLDALLERSDFVTINCSYNEQLKHMIDYQAIQKMKPTSYLINASRGPIV
YEAELVKALKEGVIEGAALDVFEFEPQITEALKSMKNVVITPHIGNATFEARDMMADIAA
TNVVKQLSGETPNYIVN
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaggtttttatcgcaggcgcaatccctgaaatgggacttagtcaacttgaaaaa
cattttgaggttgatatgtacacaggtaaaacgttaatttctgaagcattattaattcaa
aaagttcaagatgcagatgcattaatcactttattgtctactaacgtgagccgaaaagtc
attgaatcggcgccaaaactaaaaatcatagctaactatggtgctggttttaataacatt
gacatccaagctgcccgtgaacgccatattgatgttacgaatacaccgattgcttccaca
aatgcaacagcagatttaacgatgggcgttttattggctgtcgctcgccgtattcctgaa
ggcgatcaactttgccgtaacgaaggattcaatggttggtcccctttattctttagagga
cgtgaagtatcaggtaaaacaattggtattatcggcttaggagaaatcggtatggcagtt
gcaagacgtgctaaagggtttgatatgagtgtgctttacacagggccaaatcgctataaa
gataaagaagctgaattaaatgctgaatacgtcacactcgatgcacttttagaacgttca
gattttgtaactataaattgttcgtataatgaacaattaaagcatatgattgattaccaa
gcgattcaaaaaatgaaaccaacttcatacttaatcaatgcatctagagggccaattgtt
tatgaggccgaattagtcaaagcacttaaagaaggcgtgattgaaggtgctgcactggat
gtatttgaattcgaaccacaaataacagaagcgcttaaatcaatgaaaaatgtagtcatt
acaccacacattggtaatgcaacttttgaagcaagagatatgatggctgatattgcagcg
acaaacgtagtgaaacaacttagcggtgaaacacccaattatattgtgaactga

DBGET integrated database retrieval system