KEGG   Staphylococcus nepalensis: BJD96_04190Help
Entry
BJD96_04190       CDS       T05272                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
snl  Staphylococcus nepalensis
Pathway
snl00010  Glycolysis / Gluconeogenesis
snl00053  Ascorbate and aldarate metabolism
snl00071  Fatty acid degradation
snl00280  Valine, leucine and isoleucine degradation
snl00310  Lysine degradation
snl00330  Arginine and proline metabolism
snl00340  Histidine metabolism
snl00380  Tryptophan metabolism
snl00410  beta-Alanine metabolism
snl00561  Glycerolipid metabolism
snl00620  Pyruvate metabolism
snl00625  Chloroalkane and chloroalkene degradation
snl01100  Metabolic pathways
snl01110  Biosynthesis of secondary metabolites
snl01120  Microbial metabolism in diverse environments
snl01130  Biosynthesis of antibiotics
Module
snl_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:snl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BJD96_04190
   00053 Ascorbate and aldarate metabolism
    BJD96_04190
   00620 Pyruvate metabolism
    BJD96_04190
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BJD96_04190
   00561 Glycerolipid metabolism
    BJD96_04190
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BJD96_04190
   00310 Lysine degradation
    BJD96_04190
   00330 Arginine and proline metabolism
    BJD96_04190
   00340 Histidine metabolism
    BJD96_04190
   00380 Tryptophan metabolism
    BJD96_04190
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BJD96_04190
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BJD96_04190
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BJD96_04190
Enzymes [BR:snl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     BJD96_04190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh VASP_tetra
Motif
Other DBs
NCBI-ProteinID: ATH59590
UniProt: A0A291JJ55
LinkDB All DBs
Position
933314..934744
Genome map
AA seq 476 aa AA seqDB search
MRNFTKQYINGEWVESTSGETIEVINPATEEVTGIIAKGNKEDVDKAVDAAENVYFEFRH
SSVQERKELLDKIVQEYKNRKEDIIEAITDELGSPLKVSENVHYQMGLDHFQAARDALDN
FEFEERRGDDLVVKEAIGVAGLITPWNFPTNQTSLKLSAALAAGSPVVLKPSEETPFAAI
ILAEIFDKAGVPKGVFNLVNGDGQGVGNPLSEHPKVRMMSFTGSGPTGASIMRKAAEDFK
KVSLELGGKSPYIILDDADIDGAASAATGKVVTNTGQVCTAGTRTLVPESIKEEFLTAVK
EKFSQVKVGDPRAEGTQVGPIISKKQFDQVQSYIDKGVEEGAELFYGGPGKPEGLDKGYF
ARPTIFNNVDNDMTIAREEIFGPVMSIITYNDVDEAIKIANDTEYGLASYVYGKDKDTLH
KVARSIEAGTVEINEAGRKPDLPFGGYKQSGLGREWGDYGIEEFLEVKSIAGYYKA
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgagaaatttcactaaacagtatatcaacggtgaatgggttgaaagtacaagtggagaa
acaattgaagtaatcaaccctgcaacagaagaagtaacaggtattattgcgaaaggtaat
aaagaagatgttgataaagcagtagatgctgctgaaaatgtatattttgaatttagacac
agttcagttcaagaaagaaaagaattattagataaaattgttcaagaatataaaaataga
aaagaagatattattgaagcgattacggatgaattaggttctccgttaaaagtttcagaa
aatgtccattatcaaatgggattagatcatttccaagctgcacgtgatgcattggataat
tttgaatttgaagagcgccgtggggatgatttagttgttaaagaagctattggtgttgca
ggtttaatcacaccatggaatttcccaacaaaccaaacttctcttaaattgtctgcagca
ttagcagcaggcagtcccgtagtattaaaaccgtcagaagagacgccatttgcagcgatt
attttagcagaaatatttgataaagccggcgttccaaaaggagtattcaacttagtaaat
ggtgatggccaaggtgttggtaatccactaagtgaacatccaaaagtaagaatgatgtca
tttactggttctggccctacaggtgctagcatcatgagaaaagcagcagaagatttcaaa
aaagtgtcgctagagttaggtggtaaatcaccatatattatcttggatgatgctgatatt
gacggtgcagcgagtgcagctactggtaaagtagtaaccaatacaggtcaagtttgtaca
gcaggcacaagaacattagtaccagaaagtattaaagaagaatttttaacagctgtaaaa
gaaaaattcagccaagttaaagtaggcgacccacgtgcagaaggtacgcaagttggcccg
attattagtaaaaaacaatttgaccaagttcaatcatatattgataaaggtgtagaagaa
ggcgcagaattattctatggtggccctggtaaacctgaagggttggataaaggatatttc
gcacgtccaacgatctttaataacgtggataatgatatgacaattgcgcgagaagaaatt
tttggacctgtaatgtcaattatcacttataatgatgtggacgaagccatcaaaatcgca
aatgatacagaatatgggctagcatcatacgtatatggtaaagataaagacacattacac
aaggtagcgcgttcgattgaagcaggtacagttgaaattaacgaagctggacgtaaacca
gacttaccattcggcggttataaacaatcaggtttaggacgcgaatggggagactatggt
atagaagagttcttagaagttaaatctattgctggttattacaaagcatag

DBGET integrated database retrieval system