KEGG   Staphylococcus nepalensis: BJD96_06960Help
Entry
BJD96_06960       CDS       T05272                                 

Definition
(GenBank) chorismate synthase
  KO
K01736  chorismate synthase [EC:4.2.3.5]
Organism
snl  Staphylococcus nepalensis
Pathway
snl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
snl01100  Metabolic pathways
snl01110  Biosynthesis of secondary metabolites
snl01130  Biosynthesis of antibiotics
snl01230  Biosynthesis of amino acids
Module
snl_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:snl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BJD96_06960
Enzymes [BR:snl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.5  chorismate synthase
     BJD96_06960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_synt
Motif
Other DBs
NCBI-ProteinID: ATH60055
UniProt: A0A291JKG5
LinkDB All DBs
Position
1481369..1482535
Genome map
AA seq 388 aa AA seqDB search
MRYLTSGESHGPQLTVIIEGVPSNLEINVSDINEEMFKRQGGYGRGRRMQIEKDSVEIVS
GVRNGITLGSPITLIVTNDDFKHWRKIMGADPISDEDQENMKRVITKPRPGHADLIGGMK
YNHRDLRNVLERSSARETAARVAVGAVSKILLKQLDIHFYSRVMEIGGIKDDLEYDLETI
KSNVDKNDVRVINDEIAQQMRDKIDDAKKAGDTIGGVVQTVIEGVPVGVGSYVHYDRKLD
GRIAQGVVSINAFKGVSFGEGFKAAEKPGSEVQDEILYDTTNGYYRGSNHLGGFEGGMSN
GMPIVVNGVMKPIPTLYKPLNSVDINTKESFKASVERSDSCAVPAASVVVENVVAFELAK
ALLEEFQCNHIDQLKTQIEERRLLNIEY
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgagatatttaacttcaggagaatcgcacggtccacaattaacggtaattattgaaggt
gtgccatcaaatttagaaatcaatgtatcagatattaatgaagaaatgtttaaacgtcaa
ggcggatacggtagagggcgtcgtatgcaaattgagaaagatagtgttgaaattgtatca
ggcgtacgtaatgggattacacttggtagtccaattacgcttattgttacaaatgatgat
tttaaacattggagaaaaattatgggggcagacccaataagtgatgaagaccaagaaaac
atgaaacgcgtcattaccaaaccacgaccaggtcatgcagatttaattggcggtatgaaa
tataaccacagagatttaagaaatgtattagaacgctcttctgctagagaaacagcagca
cgcgtagctgtaggtgcagtttctaagattttacttaaacaacttgatattcatttttat
agtagagtcatggaaattggcggtattaaagatgatttagaatatgaccttgaaacaatt
aaatctaatgttgataaaaatgatgtccgtgtaattaacgatgaaatcgcacaacaaatg
agagataaaatagatgatgcgaaaaaagcaggtgacactataggtggagttgtccaaaca
gttattgaaggtgtacctgtaggcgttggtagctatgtgcattatgatcgcaaattagat
ggtagaatagctcaaggtgtagtgagcatcaatgcatttaagggtgtgagctttggtgaa
ggctttaaagcagcagaaaaacctggaagtgaagtacaagatgaaatactttacgataca
acaaacggctactatagagggtcaaatcatttaggtgggtttgaaggtggcatgtctaac
ggtatgcctatcgtcgttaatggtgtgatgaaacctatcccaacattatataaaccgctt
aattcagtagatataaatacaaaagaatctttcaaagcctctgttgaacgttctgacagc
tgtgctgtacctgctgcaagtgttgtagtagaaaatgtagttgctttcgaacttgcaaaa
gcgttgctagaagaattccagtgcaatcatatcgaccaattaaaaacacaaattgaagaa
cgtcgtttattaaatattgaatactaa

DBGET integrated database retrieval system