KEGG   Staphylococcus nepalensis: BJD96_07195Help
Entry
BJD96_07195       CDS       T05272                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
snl  Staphylococcus nepalensis
Pathway
snl00020  Citrate cycle (TCA cycle)
snl00310  Lysine degradation
snl00380  Tryptophan metabolism
snl01100  Metabolic pathways
snl01110  Biosynthesis of secondary metabolites
snl01120  Microbial metabolism in diverse environments
snl01130  Biosynthesis of antibiotics
snl01200  Carbon metabolism
Module
snl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
snl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:snl00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BJD96_07195
  Amino acid metabolism
   00310 Lysine degradation
    BJD96_07195
   00380 Tryptophan metabolism
    BJD96_07195
Enzymes [BR:snl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     BJD96_07195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: ATH60100
UniProt: A0A291JKK7
LinkDB All DBs
Position
1527226..1530030
Genome map
AA seq 934 aa AA seqDB search
MSNESQVSQAPVNFGANLGYILDLYDMYLNDPASVPEDLQVLFSTIKNGEANISTNTAEG
QHNVTKADSTIKRVMRLIDNIRQYGHLLADIYPVNKPVRENVPKLNIEDFNLDQETLESI
SAGIVSEHFKDIYDNAYEAIVRMEKRYKGPIAFEYTHINNNRERVWLKRRIETPYKATLN
DNQKIELFKNLAHVEGFEKYLHKNFVGAKRFSIEGVDTLVPMLQQTLRLASDEGIQNIQI
GMAHRGRLNVLTHVLEKPYEMMISEFMHTDPMKFLPEDGSLELTAGWSGDVKYHLGGVKT
TNSYGSEQRISLANNPSHLEIVAPVVLGKTRATQDDTNKPGAVQTDFYKSMPILIHGDAA
YPGQGINFEAMNLENLDGYSTGGTLHIITNNRIGFTTEPEDGRSTTYSSDVAKGYDVPIM
HVNADNVEATIEAIEIAMAFRKEFHKDVVIDLVGYRRYGHNEMDEPSITNPLPYHNIRKH
DPVDILYGNQLVEDDIISEDQMNNIFDEVQKELRAAHDKIDKNDKMDNPDMQKPDSLAEP
LESVGIDISYEQLKEINDAMLSYPSNFNVLKKLNKVLEKRREPFENEDGLVDWAQAEQLA
FATITQQGAPIRLTGQDSERGTFSHRHAVLHDPESGEEFIPLHHVPGQKATFEVRNSPLS
EAAVVGFEYGYNVQNKDCMTIWEAQYGDFSNMAQMIFDNFLFSARAKWGERSGLTLFLPH
SFEGQGPEHSSARLERFLQLAGENNSTVVNLSSSSNYFHLLRAQAASLGTQSMRPLVVMS
PKSLLRNKTVADPINKFISGQFEPILPEDHNKEAVKKVILASGKMFIDLKEYLEKNPNES
ILLVAVERLYPFPAEEIEALLSTLPNLENVAWVQEEPKNQGAWSFVYPYLKALTTDKYDL
SYHGRIQRSAPAEGDGEIHKLVQNMIIEQSTKFN
NT seq 2805 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacgaaagtcaggtttcacaggcacctgtaaatttcggggctaatcttgggtat
attttagatttatatgatatgtatctcaatgatccagcttcagttcctgaagatttacaa
gtcctatttagcacaatcaaaaacggtgaagcaaacatctcaacaaatacagctgaaggg
caacataacgtgaccaaagctgatagcacaatcaaacgtgttatgcgtttaattgataac
atacgtcaatacgggcatttattggcagatatttatccagttaacaaacctgtaagagaa
aatgttccaaaattaaatatcgaagactttaatttagatcaagaaacacttgaatctatt
tctgcaggtattgtatctgaacactttaaagacatttacgataatgcttatgaagcaatt
gttcgtatggaaaaacgttacaaaggacctattgcatttgaatatacacatatcaataat
aatagggaacgcgtatggttaaaacgtagaatagaaacaccatacaaggcgactttaaat
gacaatcaaaaaatagaattatttaaaaatttagcgcatgtagaaggttttgagaaatat
ctacataaaaattttgtaggagcaaaacgtttctcaatagaaggtgtagatacactagtg
ccaatgttacaacaaacgttaagattagctagtgatgaaggcattcaaaatatccaaata
ggcatggctcaccgcggtagattgaatgtgcttacgcatgtattagaaaaaccgtatgaa
atgatgatttcagaatttatgcatactgatccaatgaaatttttaccagaagatggcagc
ttagaattaactgcaggttggtcaggcgacgtaaaatatcatctaggcggtgtgaaaaca
accaattcatatggcagcgagcaacgcatctctcttgcaaataacccgagccatttagaa
atcgttgcaccagttgttctaggtaaaacacgtgcaacacaagatgatacaaacaaacca
ggagctgttcaaacagacttctataaatcaatgcctattttaatacatggtgatgcagcg
tatcctggtcaaggcatcaattttgaagcgatgaatttagaaaacttagatggctattca
acgggcggaacgcttcacatcattactaataatagaattggctttacgacagagcctgaa
gatgggcgttctacaacgtattcatcagacgtggctaaaggttatgatgttcctattatg
catgtaaatgcagataatgttgaagctactattgaagcgattgaaatagcgatggcattt
agaaaagaattccataaagatgttgtgattgatttggttggttatcgtagatatggccac
aatgaaatggatgaaccttcaatcacgaatccattaccttaccataatattcgtaaacac
gacccagtagatattttatacggcaatcaattagttgaagatgacatcatctcagaagat
caaatgaacaatatatttgatgaggttcaaaaagaactacgtgctgctcacgataaaatt
gataaaaatgataaaatggataacccagatatgcaaaaaccagatagtcttgcagaacct
cttgaaagcgtcggtatcgatataagttatgaacaacttaaagaaattaacgatgccatg
ttatcatacccatcaaacttcaatgtacttaagaagctaaataaagtactagagaaacgt
agagaaccttttgaaaacgaagatggattagttgactgggctcaagcagaacaattagcg
ttcgcaacaataacacaacaaggtgcaccaatccgtttaacaggtcaagacagtgaacgt
ggcacatttagccatcgtcacgcggtattacatgacccagaatctggtgaagaatttatc
ccattacaccatgtacctggccaaaaagcgacttttgaagtacgtaactcaccattatca
gaggcagcagttgttggttttgaatacggttataatgttcaaaataaagattgtatgaca
atttgggaagcacaatatggagatttttcaaatatggctcaaatgatatttgataacttc
ttatttagcgctagagctaaatggggtgaacgttcaggtttaactctattcttacctcat
tcgtttgaaggacagggtcctgagcattcatcagctcgattggaaagattcttacaatta
gcaggagaaaacaactcaactgttgtaaacttatcaagttcaagcaactatttccatttg
ttaagagcacaagcagcaagtttaggtacgcaatctatgagacctttagtagttatgtct
cctaagagtctattgcgcaataaaacagtagctgatccaatcaataaatttatatctgga
caatttgaaccaatcttaccagaagatcacaataaagaagctgttaaaaaggttattctt
gcttcaggtaaaatgttcattgatttaaaagaatatttagagaaaaatccaaacgaatcc
attttattggttgctgtcgaaagattatacccattcccagcagaagaaatcgaagcactg
ctcagtacattacctaacttagaaaatgtcgcttgggtacaagaagaaccgaaaaaccaa
ggcgcatggtcatttgtttatccatatctcaaagcattgactactgataaatacgattta
agttatcacggtcgtatccaacgttcagcaccagctgaaggcgatggtgaaatacacaaa
ctcgttcaaaatatgattatcgaacaaagcacaaaatttaactag

DBGET integrated database retrieval system