KEGG   Staphylococcus nepalensis: BJD96_08590Help
Entry
BJD96_08590       CDS       T05272                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
snl  Staphylococcus nepalensis
Brite
KEGG Orthology (KO) [BR:snl00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:snl01001]
    BJD96_08590
Enzymes [BR:snl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     BJD96_08590
Protein kinases [BR:snl01001]
 Serine/threonine kinases: Other
  Bacterial family
   BJD96_08590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Pkinase_fungal Kinase-like RIO1 Kdo ISK_Channel
Motif
Other DBs
NCBI-ProteinID: ATH60354
UniProt: A0A291JKG2
LinkDB All DBs
Position
complement(1827407..1829461)
Genome map
AA seq 684 aa AA seqDB search
MIGKLISERYKVIKKLGGGGMSIVYLADDTILNRKVAIKAIRIPSGEKEETIKRFEREVH
NLTQLSHKNIVNVFDVTENDEYFFLVMECIEGPTLSEYIQQHRPLDIQTVINFTEQIIEG
IKHAHDTKIVHRDIKPQNILINSDQTLKILDFGIAKALSETTMTQTNHVLGTVQYLSPEQ
ARGDSTDNGTDIYSIGVVLYEMLVGHPPFSGETAVSIAIKHIQDPMPNVTDKRPEVPQSL
SNVVLKATEKNKAERYQSVKEMLEDLSTVLSQERMNDARYYSVDADTKTVPINKAEIANQ
SREEDKSKNMHQTMQIPIVNQQYFQTNEEQLYAVPPKKRSKKKKFFYGLIIVLLLFGLFG
FMAMGMFGNKYLETPNLIGKTEKEAEGILKENKLDLGKTSREYSDKYPENKIIKTTPGKG
ERLEQNSKVDIVLSKGPKTAEMPNLYGLPKSEALDKLKDLGIDDAQVDQSYTKQNVSKGL
IETQNISPGERVKISNSNIKLTESLGIKQIYVDDYEDKSFKTAKSELESKGFKVVTVEKR
SDKSVDKDSVISQSPKDKEVDEGSTIEFVVSTGKPESKEKKEDKDSEKKEDDDSSDSDKD
EKKETKEYTETYQVSYTGDDDESQEVKVYVRDKDDEGTSAAQSFKIKDDKTVTIPMTIEE
GETAGYTIRVDGKVVADKDIPYDF
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgattggaaaactaataagtgaacgttataaagtgattaaaaaacttggcggcggtggc
atgagtatagtgtatttagctgatgacaccattttgaatcgaaaggtagcaattaaagcg
attagaataccttctggtgagaaagaagaaacgattaaacgttttgagcgtgaagttcat
aatttaacacaactttcacataaaaatatagtgaacgtttttgatgttactgaaaatgat
gaatatttcttcttagtcatggaatgtatagaaggccccactttgtctgaatatattcaa
caacatcgtcctttagatatccaaactgttatcaattttacggaacaaattatagaggga
ataaaacatgcgcatgatacaaagattgtacatcgtgatataaaacctcaaaacatattg
ataaatagtgatcaaacgttaaaaatattagacttcggtattgcaaaagctttgagtgaa
acaacaatgacgcaaactaaccatgttttaggtactgttcaatatctttctccagaacaa
gctcgtggtgactctacagataatggcactgatatctattccataggtgttgtcttatat
gaaatgcttgtaggtcatcccccattctctggtgagacggctgtaagtattgccataaag
catattcaagatcctatgcctaacgttacagataaacgaccagaagtaccacaatcgtta
agtaatgtcgtacttaaagctacagaaaaaaataaagcagaacgttatcaatctgttaaa
gaaatgctagaagatttatcaacggtgttatcacaagaacgcatgaatgacgcaagatac
tattctgtggatgcggatactaaaactgtgcctattaataaagcagaaattgccaaccaa
tcacgcgaagaagataaatcgaaaaatatgcaccaaacaatgcaaattccaattgttaac
caacaatattttcaaacgaatgaagagcaattatatgcagtacctcctaaaaagaggtct
aaaaagaaaaagtttttctatggtttgatcattgtgttacttttatttgggctttttgga
tttatggctatgggcatgtttggtaataaatatttagaaactcccaatttgataggcaaa
actgaaaaagaagcagaaggcattctaaaagaaaataaattagatttaggtaaaacgtca
cgtgaatatagtgataaatatcctgaaaataaaattattaaaacaacgccaggtaaaggt
gaacgtttagaacaaaacagcaaagttgatattgttttatctaaaggccctaaaacagca
gaaatgcctaatttatatggattacctaaatcagaagcgttagataaattaaaagattta
ggaatcgatgacgcacaagtcgatcaatcttataccaaacaaaatgtgtcaaaaggttta
attgaaacacaaaatatctcaccaggcgaaagagtgaaaatcagtaatagcaatattaaa
ttgacagaatcactaggtataaaacagatatatgtagatgactatgaggacaaatcattt
aaaactgctaaatctgaattagaatcaaaagggtttaaagtagtgactgtagaaaaacgt
tcagacaaatcggtcgataaggatagcgtaattagccaatcaccgaaagataaagaagtt
gacgaaggatctactatagaatttgtagtttctacaggcaagcctgaatccaaagagaaa
aaagaggacaaagattcagagaaaaaagaagatgatgactcatcagattctgataaggat
gagaaaaaagaaaccaaggaatatacagaaacataccaagtgtcatatactggtgatgat
gatgagagtcaagaagtaaaggtatatgtacgtgataaagatgatgaagggacgtcagct
gcgcaaagtttcaaaataaaagatgacaagacagtcactattcctatgacaatcgaagaa
ggtgaaacggcgggttatacgatccgtgtggatggtaaagtcgttgcagataaagatatc
ccttacgatttttag

DBGET integrated database retrieval system