KEGG   Staphylococcus nepalensis: BJD96_13120Help
Entry
BJD96_13120       CDS       T05272                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
snl  Staphylococcus nepalensis
Brite
KEGG Orthology (KO) [BR:snl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BJD96_13120
Enzymes [BR:snl01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BJD96_13120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox HI0933_like Thioredoxin_3 GIDA DAO FAD_binding_2 Thi4 FAD_oxidored NAD_binding_8 AlaDh_PNT_C K_oxygenase NAD_binding_9 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ATH61158
UniProt: A0A291JNX5
LinkDB All DBs
Position
2754786..2756309
Genome map
AA seq 507 aa AA seqDB search
MLNDQLKSQLQQLLQLMEGDVVLSASLGSDDKSKELKELLDEVAAASSNITIEAKDLKRT
PSFTVNRPDEDTGVTFAGLPMGHEFNSLVLALLQVSGRAPKEEQSVIDQIKALDRPLNFE
TYISLTCQKCPDVVQALNLMSLLNPNITHTMVDGAIFRDESEDIMAVPAIYLNGEEFGNG
RMTVQDILTELGSKVDPSEFNDKAPYDVLIVGGGPASGSAAIYTARKGLRTGIVADRIGG
QVNDTATIENFVTVKETDGPKFSSALEDHVKQYNVDMMTGVRASDIEKTDNGIVVTLDND
AKLQSKTVIIATGARWRKLEVPGEEALINKGVAFCPHCDGPLFENKNVAVVGGGNSGVEA
AIDLAGIVEHVTLFERNASLKADDVLQERLSALPNVTIIKNAQTTEVLGENSVTGLKYQD
KETGEDHTVELEGIFVQIGLLPNTEWLDNYVELNQANEIIIDRTNATSIPGIFAAGDVTD
DRNKQIIISMGAGANAALNAFDYIIRH
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgcttaatgatcagctaaaatcacaattgcaacaattacttcaattgatggaaggtgac
gttgtactaagtgcaagtcttggttcagatgataaatctaaagaattaaaagaattgcta
gacgaagtagctgcagcgtcttcaaacataacaattgaagcaaaagacctaaaacgtacg
ccaagctttactgttaatagacctgatgaagacacgggtgtaacatttgctggtttacct
atgggtcatgagtttaattctcttgtattagctttattacaagtaagtggtcgtgcgcct
aaagaagaacaatctgtcatagatcaaattaaagctttagaccgcccgcttaattttgaa
acgtatatcagtttaacatgtcaaaaatgccctgatgttgttcaggctttaaatttaatg
agcttattaaatcctaatatcactcacactatggttgatggtgcaatctttagagatgaa
tctgaagatatcatggcagtgcccgctatctatttaaatggtgaagaatttggtaatggc
cgtatgactgttcaagatatattaactgaattaggcagtaaagtagacccatcagagttt
aatgataaagcgccttatgacgtgttaatcgttggtggtggccctgcaagtgggagtgct
gcgatttacacagctcgtaaaggattacgcactggtattgttgccgatcgcatcggcggg
caagtgaatgatactgcaacaattgaaaactttgtcactgttaaagaaacagacggacct
aagttttcatctgcacttgaagatcatgtaaaacagtataatgttgatatgatgacaggt
gtcagagcgagcgacattgaaaaaacagataacggtatagttgttactttagataatgac
gctaaattacaaagtaaaactgttatcattgctacaggtgcacgttggcggaaactagaa
gtacctggtgaagaagcgcttatcaataaaggcgttgcattctgtccgcactgtgacggt
cctttattcgaaaataaaaacgtcgctgtcgtaggaggcggaaactctggtgttgaagct
gcaatagacttagcaggtattgtagagcacgtaacactatttgaacgtaacgctagcctt
aaagcagatgacgtactacaagaacgtttgagcgctttaccaaacgttacaattattaaa
aatgctcaaactactgaagtgcttggtgaaaattcagttactggtcttaaataccaagac
aaagaaacgggcgaagaccatactgttgaattggaaggtatattcgttcaaatcgggtta
ctaccaaatacagaatggcttgataattatgtcgaattaaatcaagcgaatgaaattata
attgatcgtaccaacgccacaagtattcctggcatattcgcagcaggtgacgtaacagac
gatcgtaacaaacaaattataatttcaatgggcgctggcgcaaatgccgcactcaatgca
tttgattatattattcgtcactaa

DBGET integrated database retrieval system