KEGG   Streptococcus pneumoniae 70585 (serotype 5): SP70585_1408Help
Entry
SP70585_1408      CDS       T00872                                 

Definition
(GenBank) prephenate dehydratase (PDT)
  KO
K04518  prephenate dehydratase [EC:4.2.1.51]
Organism
snm  Streptococcus pneumoniae 70585 (serotype 5)
Pathway
snm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
snm01100  Metabolic pathways
snm01110  Biosynthesis of secondary metabolites
snm01130  Biosynthesis of antibiotics
snm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:snm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SP70585_1408
Enzymes [BR:snm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     SP70585_1408
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDT ACT ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: ACO17806
UniProt: C1C7X0
LinkDB All DBs
Position
complement(1305228..1306076)
Genome map
AA seq 282 aa AA seqDB search
MKIAYLGPKGSFSHHVVQIAFPHEELQAFANITDVIKAYEQGLVDYSVVPVENSIEGSVH
ETLDYLFHQAHIQAVAEIVQPIHQQLMVVPGHTKIEKIFSHPQALAQGKKFIDEQYPEAQ
IEVTASTAYAARFISEHPDQPFAAVAPRSSAEEYGLELIAEDIQEMEANFTRFWLLGAEK
PSIPLQAQTEKMSLALTLPDNLPGALYKALSTFAWRGIDLTKIESRPLKTALGEYFFIID
VDYTDKDLVHFAQKELEAIGIQYKILGAYPIYPISDHGKERR
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgcttatctaggtcccaagggatcattttcacaccacgttgtgcagatagct
tttcctcatgaggaattgcaggcttttgccaacattacagatgtcatcaaggcttatgag
caaggattagtggactattctgtggtgccagttgaaaattctattgagggtagtgttcat
gaaaccttggactatctttttcatcaggctcacatccaagcagtagcagaaatcgttcag
cctattcatcagcagttgatggtggttccaggccatactaagattgaaaagattttttca
catccacaggccttggctcaaggaaagaaattcatcgatgaacaatatccagaggctcaa
atcgaggtaacagctagtacagcttatgcggcccgttttatttccgaacatccagatcag
ccctttgcagcagttgcacctagaagttctgctgaagaatatggattggaactgattgcc
gaggatattcaggaaatggaagccaatttcacacgtttctggcttctaggagctgaaaag
cctagtattcccttgcaagcacaaactgaaaagatgagtttggccttgacattacctgac
aaccttccaggtgcactttataaggccctgtcgacctttgcttggcgaggaattgacttg
acaaaaattgaaagtcgtccactcaagacagcactgggtgaatactttttcattatcgat
gtggattataccgataaggacttggtccactttgcccaaaaagaattagaagcgattgga
atccagtataaaattctgggtgcctatcctatttatccaatatcagaccatggaaaggag
agaagatga

DBGET integrated database retrieval system