KEGG   Streptococcus pneumoniae 70585 (serotype 5): SP70585_1903Help
Entry
SP70585_1903      CDS       T00872                                 

Definition
(GenBank) type II restriction enzyme
  KO
K01155  type II restriction enzyme [EC:3.1.21.4]
Organism
snm  Streptococcus pneumoniae 70585 (serotype 5)
Brite
KEGG Orthology (KO) [BR:snm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic Defense System [BR:snm02048]
    SP70585_1903
Enzymes [BR:snm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.4  type II site-specific deoxyribonuclease
     SP70585_1903
Prokaryotic defense system [BR:snm02048]
 Restriction and modification system (R-M system)
  Type II R-M system
   Restriction endonucleases
    SP70585_1903
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DpnII Fibrinogen_C
Motif
Other DBs
NCBI-ProteinID: ACO18002
UniProt: C1C9B4
LinkDB All DBs
Position
complement(1768249..1769115)
Genome map
AA seq 288 aa AA seqDB search
MKQTRNFDEWLSTMTDTVADWTYYTDFPKVYKNVSSIKVALNIMNSLIGSKNIQEDFLDL
YQNYPEILKVVPLLIAKRLRDTIIVKDPIKDFYFDFSKRNYSIEEYTMFLEKSGIFDLLQ
NHLVSNLVDYVTGVEVGMDTNGRKNRTGDAMENIVQSYLEAEGYILGENLFKEIEQNEIE
EIFSVDLSAITNDGNTVKRFDFVIKNEQVLYLIEVNFYSGSGSKLNETARSYKMIAEEIK
AIPNVEFMWITDGQGWYKAKNNLRETFDILPFLYNINDLEHNILKNLK
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaactagaaattttgatgagtggttgtcaacgatgaccgacacagtagctgac
tggacttattatacagattttcccaaggtttataaaaatgtatctagtataaaagttgct
ctaaatattatgaatagtcttattggtagtaaaaatatacaagaggattttttagactta
tatcaaaattatccagaaattttgaaagttgtgcctctacttattgctaaacgtttgaga
gatacgattattgttaaggatccgataaaagatttctattttgattttagtaaacgaaac
tatagtattgaagaatatactatgtttttggaaaaatcaggtatatttgatttattgcaa
aatcatttagtatcaaatttagttgactacgttacaggtgttgaggttggtatggatact
aatgggcgcaaaaatcggactggagatgcgatggaaaatattgttcaaagttatcttgaa
gctgaagggtatattttaggagagaatttatttaaagagattgaacaaaatgaaatagag
gaaattttttctgtcgatttatctgctattacgaatgatgggaatactgtgaaacgtttt
gattttgtcataaaaaatgaacaagtgctttatctgattgaggttaatttttattcagga
agtggttcaaaattaaatgagacggctagatcttacaaaatgattgctgaagaaattaaa
gctattcctaatgttgagtttatgtggattactgatggacaaggttggtataaggctaag
aataatttacgagaaacatttgatattttaccattcttatataatattaacgatttggaa
cataatattttaaagaatttgaaatag

DBGET integrated database retrieval system