KEGG   Sphaerotilus natans: EWH46_01430Help
Entry
EWH46_01430       CDS       T06182                                 

Definition
(GenBank) RNB domain-containing ribonuclease
  KO
K01147  exoribonuclease II [EC:3.1.13.1]
Organism
snn  Sphaerotilus natans
Brite
KEGG Orthology (KO) [BR:snn00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:snn03016]
    EWH46_01430
Enzymes [BR:snn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     EWH46_01430
Transfer RNA biogenesis [BR:snn03016]
 Prokaryotic type
  3'processing and CCA adding factors
   3'processing factors
    EWH46_01430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNB RNase_II_C_S1 Myosin_N
Motif
Other DBs
NCBI-ProteinID: QEM99567
UniProt: A0A5C1PW36
LinkDB All DBs
Position
complement(256020..258092)
Genome map
AA seq 690 aa AA seqDB search
MNALFEDAGKFLAGRVLSEAESSMQVELDSGKRVKVKAANVLLKFDKPAPAVLIAEGQRL
AEEIDLDLAWEFAPEGEFGFADLARDYFEAGAGTSHQAAALFRLFGAPHYFRRMGRGQFR
KAPEEIVKAALLAIEKKAQLAAQIEGWAAELVAGQCPQPVREQLYKILFKPDKNAPEYKA
VVDAAKKAQRAPLDLLVAAGAIDSPYQFHWRRFLFEQFPKGAGFPASLVAPEIRDELPLA
AGVRAFSIDDSATTEIDDALSVQGLGSGTIVFGVHIAAPALAIQPDSAIDKVARDRFSTV
YMPGWKLTMLPDEVVQSYTLQEGRDCPAVSLYVTMDEATLELKSTETKLERVPIVANLRH
DKLDAVVTEAALSGEAPADFDFAPELAFGWRLARHLKAQREVVRGKPENFNRPDYNFRLQ
DADGQSPSAPPDGRETVVISERRRGAPLDTIVAEAMILANNTWGGWLAELGVPGIYRSQA
SMAPGVKVRMSTKALPHAGMGVAHYTWATSPLRRYVDLVNQWQIIACARHGRTAALAAHF
KPKDTALFAIISGFDAAYSAYNGFQNGIERYWTLRWLQQNGVTELDCAAMKDGLVRADTL
PLVLRAVGADGLPRGARVRVRLGEPDLLTLEIGGSVIARLDDPTRADDDAVIEDEAEEGA
EAAATGLALAIDVADADAPAAADGGAAPAA
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccctcttcgaagacgccgggaagttcctcgccggccgcgtgttgtcggaagcc
gagagctcgatgcaggtcgagctggactcgggcaagcgcgtcaaggtcaaggcggccaat
gtgctgctgaagttcgacaagcccgcgccggccgtgctgatcgccgagggccagcgcctg
gccgaggagatcgacctggatctggcctgggaattcgcgcccgagggcgagttcggcttc
gccgatctggcgcgcgactacttcgaggccggcgccggcacgagccaccaggccgcggcg
ctgttccgcctgttcggcgcgccgcactatttccgccgcatgggccgcggccagttccgc
aaggcgcccgaggagatcgtgaaggccgccctgctcgcgatcgagaagaaggcgcagctc
gccgcgcagatcgagggctgggcggccgagctggtcgccggccagtgcccgcagccggtg
cgcgagcagctctacaagatcctgttcaagccggacaagaacgcgccggaatacaaggcg
gtggtcgacgccgcgaagaaggcccagcgcgcgccgctggacctgctggtggccgcgggc
gccatcgacagcccctaccagttccactggcgccgcttcctgttcgagcagttcccgaag
ggcgcgggcttcccggcctcgctggtggcgccggagatccgcgacgagctgcccctggcc
gcgggcgtgcgcgccttctcgatcgacgactcggccaccaccgagatcgacgacgcgctc
tcggtgcagggcctgggcagcggcaccatcgtcttcggcgtgcacatcgccgcgccggcg
ctggcgatccagccggactcggccatcgacaaggtcgcgcgcgaccgcttctccaccgtc
tacatgccgggctggaagctgaccatgctgcccgacgaggtggtgcagagctacacgctg
caggagggccgcgactgcccggccgtgtcgctctacgtcacgatggacgaggccacgctg
gagctgaagtccaccgagacgaagctcgagcgcgtgcccatcgtcgccaacctgcgccat
gacaagctggatgcggtcgtgaccgaggcggcgctgagcggcgaggcgcccgccgacttc
gacttcgcgcccgagctggccttcggctggcggctggcccggcacctgaaggcgcagcgc
gaggtggtgcgcggcaagccggagaacttcaaccggcccgactacaacttccgcctgcag
gatgccgacggccagtcgccgagcgcaccgcccgacggccgcgagacggtggtcatcagc
gagcgccgccgcggcgcgccgctcgacaccatcgtcgccgaggcgatgatcctggccaac
aacacctggggcggctggctggccgagctgggcgtgccgggcatctaccgcagccaggcc
agcatggcgccgggcgtgaaggtgcgcatgtcgaccaaggcgctgccgcacgccggcatg
ggcgtggcgcactacacctgggcgacctcgccgctgcgccgctatgtcgacctggtcaac
cagtggcagatcatcgcctgcgcgcgccacggccgcaccgcagcgctggcggcgcacttc
aagcccaaggacaccgcgctgttcgcgatcatctcgggcttcgacgccgcctactcggcc
tacaacggcttccagaacggcatcgagcgctactggacgctgcgctggctgcagcagaac
ggcgtgaccgaactcgactgcgccgcgatgaaggacggcctggtgcgcgccgacacgctg
ccgctggtgctgcgtgcggtcggcgccgacggcctgccgcgcggcgcgcgggtgcgggtg
cgcctgggcgagccggacctgctgacgctggagatcggcggcagcgtgatcgcccgcctg
gatgatccgacccgcgcggacgacgacgcggtgatcgaggacgaggccgaggaaggcgcc
gaggccgccgccaccggcctggcgctggccatcgacgtggccgatgccgacgcgccggcc
gcggccgacggcggcgccgcaccggccgcctga

DBGET integrated database retrieval system