KEGG   Sphaerotilus natans: EWH46_04815Help
Entry
EWH46_04815       CDS       T06182                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
snn  Sphaerotilus natans
Brite
KEGG Orthology (KO) [BR:snn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    EWH46_04815 (ahpF)
Enzymes [BR:snn01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     EWH46_04815 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored AlaDh_PNT_C HI0933_like NAD_binding_7 Glutaredoxin DAO FAD_binding_3 Thi4 K_oxygenase FMO-like NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: QEN00170
UniProt: A0A5C1PZR0
LinkDB All DBs
Position
complement(1021892..1023472)
Genome map
AA seq 526 aa AA seqDB search
MLDSNLKTALKGYLERLVQPIEIVTFADDGENSRQMLELVADIASVAPAGRLSVRSGSTA
GERLPSFQITLAGLDTGVRFAGLPMGHEFTSLILALLQTSGYPAKVEADLIEQIKALEPA
QELVFETYMSLTCHNCPDVVQAINLMAALNPKIRHTTIEGSMFQAEVESRQIMGVPCVFL
NGEMFASGRMELGEILAKIDTGAADREAKKLSAKEAFDVLVVGGGPAGAAAAIYAARKGI
RTGVAAERFGGQVLDTLGIENFISVKETEGPKLAAALEQHVKEYDVDIMNLQRATALVPA
AAPGGLIEVKLENGASLRSKSVIISTGARWRSMNVPGEAEYRTKGVAYCPHCDGPLFKGK
RVAVIGGGNSGVEAAIDLAGIVAHVTLIEFDSKLRADAVLQTKLRSLPNVTILMSAQTTE
VHGDGQKVNGLSYKDRVSGELRRVDLEGIFVQIGLLPNSDWLKGTVELSPRGEVIVDSHG
QTSVPGVFAAGDVTTVPYKQIIIAMGEGAKASLGAFDHLIRSSVAG
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgctggacagcaacctcaagaccgcactgaagggctacctcgagcgcctggtgcagccg
atcgagatcgtcaccttcgccgacgacggcgagaactcgcgccagatgctcgaactggtc
gccgacatcgcctcggtcgcgccggccggccgcctgagcgtgcgcagcggctcgaccgcc
ggcgagcgcctgccctccttccagatcaccctggctggccttgacaccggcgtgcgcttc
gccggcctgccgatgggccacgagttcacctcgctgatcctggcgctgctgcagaccagc
ggctacccggccaaggtcgaggccgacctgatcgagcagatcaaggcgctcgagccggcg
caggaactggtcttcgagacctacatgtccctgacctgccacaactgcccggacgtggtg
caggcgatcaacctgatggcggcgctgaacccgaagatccgccacaccaccatcgaaggc
tcgatgttccaggccgaggtcgagtcgcgccagatcatgggcgtgccctgcgtgttcctg
aacggcgagatgttcgccagcggccgcatggagctgggcgagatcctggccaagatcgac
accggcgcggccgaccgcgaggcgaagaagctctcggccaaggaggcgttcgacgtgctg
gtggtcggcggcggcccggccggcgcggcggcggccatctacgccgcccgcaagggcatc
cgcaccggcgtggcggccgagcgcttcggcggccaggtgctcgacaccctgggcatcgag
aacttcatctcggtcaaggagaccgaggggccgaagctcgccgccgcgctggagcagcac
gtcaaggaatacgacgtggacatcatgaacctgcagcgcgccaccgccctggttccggcg
gccgcgccgggcggcctgatcgaggtcaagctcgagaacggtgccagcctgcgcagcaag
agcgtgatcatctcgaccggcgcgcgctggcgctcgatgaacgtgcccggcgaggcggaa
taccgcaccaagggcgtggcctactgcccgcactgcgacggcccgctcttcaagggcaag
cgcgtcgcggtgatcggcggcggcaactcgggcgtcgaggcggcgatcgatctggccggc
atcgtggcccatgtgacgctgatcgagttcgactcgaagctgcgcgccgacgcggtgctg
cagaccaagctgcgcagcctgccgaacgtcacgatcctgatgtcggcgcagaccaccgag
gtgcacggcgacggccagaaggtcaacggcctgtcgtacaaggaccgcgtcagcggcgag
ctgcgccgcgtcgatctggaaggcatcttcgtgcagatcggcctgctgcccaacagcgac
tggctcaagggcacggtcgagctgagcccgcgcggcgaggtcatcgtcgacagccacggc
cagacctcggtgccgggcgtgttcgccgccggcgacgtgaccacggtgccctacaagcag
atcatcatcgcgatgggcgaaggcgcgaaggcctcgctgggcgccttcgaccacctgatc
cgcagcagcgtggccggctga

DBGET integrated database retrieval system