KEGG   Sphaerotilus natans: EWH46_19255Help
Entry
EWH46_19255       CDS       T06182                                 

Definition
(GenBank) YHS domain-containing protein
  KO
K16242  phenol/toluene 2-monooxygenase (NADH) P3/A3 [EC:1.14.13.244 1.14.13.243]
Organism
snn  Sphaerotilus natans
Pathway
snn00361  Chlorocyclohexane and chlorobenzene degradation
snn00362  Benzoate degradation
snn00623  Toluene degradation
snn01100  Metabolic pathways
snn01120  Microbial metabolism in diverse environments
snn01220  Degradation of aromatic compounds
Module
snn_M00548  Benzene degradation, benzene => catechol
Brite
KEGG Orthology (KO) [BR:snn00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EWH46_19255
   00361 Chlorocyclohexane and chlorobenzene degradation
    EWH46_19255
   00623 Toluene degradation
    EWH46_19255
Enzymes [BR:snn01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.243  toluene 2-monooxygenase
     EWH46_19255
    1.14.13.244  phenol 2-monooxygenase (NADH)
     EWH46_19255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phenol_Hydrox YHS
Motif
Other DBs
NCBI-ProteinID: QEN02992
UniProt: A0A5C1Q9Z7
LinkDB All DBs
Position
pSna507_unt10:complement(147390..148988)
Genome map
AA seq 532 aa AA seqDB search
MTATVAPTAQATPAAAPTRKLGLKESHALLTQDLGWTPSYQPPEAVYPLTAFEGIRIHDW
SGWEDPFRLTMDAYWKYQGEKERKLYAIIDAFQQNNGQFNVSDARYIQALKLFVNGVIGL
EYTAHRGFAMIGRELPGTGARIAAQMQSIDELRHAQTQIHALSHYNRFFTGMAEFPHQFD
RTWYLSIPKSFFEDAISAGPFEFIVAISFSFEYVLTNLVFMPWMSGAAYNGDLSTVSFGF
SAQSDEARHMTLGIEVIKFLLEQDPANVPIVQGWIDKWFWRGYRLLTLVAAMMDYMLPKR
VMSWHEAWEIYFEQNGGALFKDLARYGIRMPVHWEVTVEEKTHASHQLWSTFYQYRHAAG
FPVWLPSAEEMDWLSAKYPDSFDRLYRPRYEHWARMAAEGRPFVNGTLPQLCQVCQWPML
FTEPGDPTQICHREEKYLGETFHCCSDGCRDIFRHEPEKYVHAHLPVHQIYQGTQFHPDS
DPGAPDFNPHVAALRYMGIEPGVDGGDFDTHADARHWTEWTGRPASLHGPAA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccaccgtcgcccccaccgcccaggccaccccggccgccgcccccacccgcaag
ctcggcctgaaggaaagccacgcgctgctgacccaggacctgggctggacgccgagctac
cagccgcccgaggcggtctacccgctgaccgccttcgagggcatccgcatccacgactgg
agcggctgggaagacccgttccggctgacgatggacgcctactggaaataccagggcgag
aaggagcgcaagctctacgccatcatcgacgccttccagcagaacaacggccagttcaac
gtcagcgacgcgcgctacatccaggcgctcaagctcttcgtcaacggcgtcatcgggctg
gaatacaccgcgcaccgcggcttcgcgatgatcgggcgcgagctgccgggcaccggcgcg
cgcatcgccgcgcagatgcagtcgatcgacgagctgcgccatgcgcagacccagatccat
gcgctgtcgcactacaaccgcttcttcaccgggatggcggagttcccgcaccagttcgac
cgcacctggtacctgtcgatcccgaagtccttcttcgaggacgcgatcagcgccgggccg
ttcgagttcatcgtcgcgatcagcttctccttcgagtacgtgctgaccaatctggtgttc
atgccgtggatgtcgggcgcggcctacaacggcgacctctcgacggtgagcttcggcttc
agcgcgcagagcgacgaggcgcgccacatgacgctgggcatcgaggtgatcaagttcctg
ctcgagcaggatccggccaacgtgccgatcgtgcagggctggatcgacaagtggttctgg
cgcggctaccggctgctgacgctggtggcggcgatgatggactacatgctcccgaagcgc
gtgatgagctggcacgaggcctgggagatctacttcgagcagaacggcggcgcgctcttc
aaggacctggcgcgctacggcatccgcatgccggtgcactgggaggtcaccgtcgaggag
aagacgcacgccagccaccagctctggagcaccttctaccagtaccgccacgcggcgggc
ttcccggtgtggctgccttcggccgaagagatggactggctgtcggccaagtacccggac
agcttcgaccgcctctaccggccgcgctacgagcactgggcgcgcatggccgccgagggc
cggcccttcgtcaacggcacgctgccgcagctctgccaggtctgccagtggccgatgctg
ttcaccgagccgggcgacccgacgcagatctgccaccgcgaggagaagtacctcggcgag
accttccactgctgctccgacggctgccgcgacatcttccgccacgagccggaaaagtat
gtgcatgcgcatctgccggtgcaccagatctaccagggcacgcagttccatccggacagc
gaccccggcgcacccgacttcaacccgcatgtggcggcactgcgctacatgggcatcgag
ccgggcgtggacggcggcgacttcgacacccacgccgacgcgcgccactggaccgaatgg
accggccgcccggccagcctgcacggaccggccgcctga

DBGET integrated database retrieval system