KEGG   Starkeya novella: Snov_0400Help
Entry
Snov_0400         CDS       T01258                                 

Definition
(GenBank) nitrate ABC transporter, inner membrane subunit
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
sno  Starkeya novella
Pathway
sno00910  Nitrogen metabolism
sno02010  ABC transporters
Module
sno_M00438  Nitrate/nitrite transport system
sno_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:sno00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    Snov_0400
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Snov_0400
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sno02000]
    Snov_0400
Transporters [BR:sno02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    Snov_0400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ADH87733
UniProt: D7A315
LinkDB All DBs
Position
403949..404860
Genome map
AA seq 303 aa AA seqDB search
MSLTALKSETTVPPKPAAGGKSGAKVVRLVFPARPAAAPGRFATLGHSLAVTLVPPLVVL
MLLLGLWELLCAGPGATLPPPSSIWQDSYDLIVDPFFVNGPQDIGLGWRVLVSLQRVAIG
FGLAAGVGILLGVLIGQSVWAMRGLDPIFQVLRTVPPLAWLPIALAAFRDSNPSAIFVIF
ITAIWPVIINTAVGVRNIPQDYRNVAQVLRLNPFEFFAKIMLPAAAPYIFTGLRIGVGLS
WLAIVAAEMLTGGVGIGFFIWDAWNSSRLSDIIVALVYIGVVGFVLDRLVAGIGAFVTRG
TAA
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgtccctcaccgccctgaagagcgagacgaccgtgccgccgaagcccgccgccggcggc
aagagtggcgccaaggtcgtccgcctcgtcttcccggcccgcccggccgccgcgccgggg
cgtttcgcgaccctcggtcattcgctcgccgtcaccctggtgccgccgctcgtcgtgctg
atgctgctgctcgggctgtgggagctgctctgcgccgggcccggcgccaccctgccgcca
ccttcatcgatctggcaggactcttacgacctcatcgtcgacccgttcttcgtcaacggg
ccgcaggatatcggccttggctggcgcgtgctggtgtcgctgcagcgcgtcgccatcggc
ttcggcctcgcggctggcgttggcatcctgctcggcgtgctgatcggccagtcggtctgg
gcgatgcgcgggctcgacccgatcttccaggtgctgcgcaccgtgccgccgctcgcctgg
ctgccgatcgcgctcgccgccttccgcgacagcaacccctcggcgatcttcgtgatcttc
atcaccgccatctggccggtgatcatcaacaccgcggtcggcgtgcgcaacatcccgcag
gactaccgcaacgtcgcgcaggtgctgcggctgaacccgttcgagttcttcgccaagatc
atgctgccggcggcggcgccgtacatcttcaccggccttcggataggcgtcggcctgtcc
tggctcgccatcgtcgccgccgagatgctcaccggcggcgtcggcatcggcttcttcatc
tgggacgcgtggaactcctcgcgcctgtccgacatcatcgtggcgctggtctatatcggc
gtggtcggcttcgtgctcgaccgcctcgtcgccggcatcggcgccttcgtcacccgcggc
accgccgcctga

DBGET integrated database retrieval system