KEGG   Starkeya novella: Snov_0429Help
Entry
Snov_0429         CDS       T01258                                 

Definition
(GenBank) Ribulose-bisphosphate carboxylase
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
sno  Starkeya novella
Pathway
sno00630  Glyoxylate and dicarboxylate metabolism
sno00710  Carbon fixation in photosynthetic organisms
sno01100  Metabolic pathways
sno01120  Microbial metabolism in diverse environments
sno01200  Carbon metabolism
Module
sno_M00165  Reductive pentose phosphate cycle (Calvin cycle)
sno_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:sno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Snov_0429
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Snov_0429
Enzymes [BR:sno01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Snov_0429
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small P3A
Motif
Other DBs
NCBI-ProteinID: ADH87762
UniProt: D7A344
LinkDB All DBs
Position
438600..439019
Genome map
AA seq 139 aa AA seqDB search
MRITQGAFSFLPDLTDEQITKQVQYCIDKGWAVNIEFTDDPHPRNTYWELWGQPMFDVRD
AAGVMFELNACRKAYAGRHYIRVSAFDSTHTWESLRLSFITDRPAEEPGFALERQEVDGR
SIRYTTRAYAANRPEGARY
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcacccagggagccttctccttcctgcccgacctgaccgacgagcagatcacc
aagcaggtgcagtactgcatcgacaagggctgggcggtgaacatcgagttcaccgacgac
ccgcacccccgcaacacctattgggagctgtggggccagccgatgttcgacgtgcgcgat
gccgccggcgtcatgttcgagctgaacgcctgccgcaaggcctatgcgggccggcactac
atccgcgtcagcgccttcgattccacccatacgtgggaatcgctgcgcctctccttcatc
accgaccgccccgccgaggagcccggcttcgcgctggagcgccaggaagtggatggacgg
tcgatccgctacaccacgcgcgcctatgccgccaaccggccggagggagcgcgctactga

DBGET integrated database retrieval system