KEGG   Starkeya novella: Snov_0505Help
Entry
Snov_0505         CDS       T01258                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sno  Starkeya novella
Pathway
sno00564  Glycerophospholipid metabolism
sno01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Snov_0505
Enzymes [BR:sno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Snov_0505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored NAD_binding_8 Pyr_redox_2 FAD_binding_3 3HCDH_N FAD_binding_2 GIDA Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: ADH87838
UniProt: D7A418
LinkDB All DBs
Position
526893..528443
Genome map
AA seq 516 aa AA seqDB search
MVARVQDEMYDLAIIGGGINGCGIARDAAGRGVSVVLLEQGDFAGATSSASTKLIHGGLR
YLEHYEFRLVREALMEREVLWAIAPHIIRPLRFVLPHHKGLRPAWLLRLGLFLYDHLGGR
KLLPATRTLDLSRDEAGKPLREGYHRAFEYSDCWVEDSRLVVLNALDAAERGADIRSHAR
VVGAERAADHWRVEVDQDGTRTTLRARVLVNAAGPWVHEVLARVIGMNSPADVRLVQGSH
IVVRKLYEHDRAYIFQNADGRIIFAIPYEHDFTLIGTTDRDFGREPAKPVASPEEIAYLC
AAASEYFKVPVTPDRVVWTYSGVRPLYDDGASKAQEATRDYVLELENGEGRPPLLSVFGG
KITTYRRLAEHALEKLAPFLSSAKKSSWTGKEPLPGGDFAVNDQPRIVAQLKRAHPWLDE
ALARRLVVAYGTRALRLLDGMRGPADLGRIFGADLSEAEVRYLMREEWARTAEDVLWRRS
KLGLRLDAEQVAALDAFMQDNAPHRLQSASLREVAR
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
gtggtcgctcgtgtacaggacgagatgtatgacctcgccatcatcggcgggggcatcaat
ggctgcggcattgcccgcgatgccgccgggcgcggggtctcggtcgtgctgctcgaacag
ggcgacttcgccggcgccacgtcctccgcctcgaccaagctgattcatggcggcctgcgc
tatctcgagcactatgagttccggctggtgcgcgaagccttgatggagcgcgaggtgctg
tgggccatcgccccgcacatcatccgcccgctgcgcttcgtgctgccgcatcacaagggg
ctgcggccggcctggctgctgcgcctcggcctgttcctctacgaccatctcggcggccgc
aagctgctgccggcgacgcgcacgctggatctttcccgcgacgaggccggcaagccgctg
cgcgagggctaccaccgcgccttcgagtattccgactgctgggtcgaggacagccgtctc
gtcgtcttgaacgcgctcgacgccgccgagcgcggcgccgacatccgctcgcatgcccgc
gtcgtcggtgcggagcgggcggccgaccactggcgcgtcgaggtcgaccaggacggcacg
cgcacgacccttcgcgctcgggtgctggtgaacgccgccggcccctgggtgcacgaggtg
ctggcgcgggtgatcggcatgaactcgccggccgatgtgcgtctcgttcagggcagccac
atcgtggtgcgcaagctctacgagcacgaccgcgcctacatcttccagaacgccgacggg
cggatcatcttcgccatcccctatgagcacgatttcacgctgattggcaccactgatcgc
gacttcggccgggagccggcgaagcccgtcgcgagccccgaggagatcgcctatctctgc
gcggcggcgagcgagtatttcaaggtgccggtgacgccggaccgggtggtgtggacctat
tccggcgtgcgcccgctctacgacgacggcgcctccaaggcgcaggaggccacgcgcgat
tacgtgctggagctggagaacggcgaggggcgaccgccgctgctctccgtcttcggcggc
aagatcaccacctatcgccggctcgccgagcatgcgctggagaagctggcgccgttcctg
tcctcggcgaagaaatcgtcctggaccggaaaggagccgctgcccggcggcgacttcgcg
gtcaacgatcagccgcgcatcgtcgcgcagctcaaacgcgcccatccctggctcgacgag
gcgctcgcacggcggctcgtcgtcgcctacggcacccgcgcgctgcgcctgctcgacggc
atgcgcgggccggccgatctcggccgcatcttcggcgccgacctttccgaggccgaggtg
cgttacctcatgcgcgaggaatgggcgcgcaccgccgaggacgtgctgtggcgccgctcc
aagctcggcctgcgcctcgatgccgagcaggtggccgctctcgatgctttcatgcaggac
aacgcgccgcatcggctacagtcggcttccctaagggaggtcgcccgatga

DBGET integrated database retrieval system