KEGG   Starkeya novella: Snov_0847Help
Entry
Snov_0847         CDS       T01258                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K05351  D-xylulose reductase [EC:1.1.1.9]
Organism
sno  Starkeya novella
Pathway
sno00040  Pentose and glucuronate interconversions
sno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Snov_0847
Enzymes [BR:sno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.9  D-xylulose reductase
     Snov_0847
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C
Motif
Other DBs
NCBI-ProteinID: ADH88172
UniProt: D7A5P8
LinkDB All DBs
Position
881502..882533
Genome map
AA seq 343 aa AA seqDB search
MKALVLERQHELKLRDIDLPLEVGPADVKIKMHTVGVCGSDVHYYTHGRIGPFIVKAPMV
LGHEAAGTVVEVGAKVTNLKVGDRVCMEPGIPDLASKASKIGLYNVDPSLTFWATPPDHG
CLTPYVVHPAAFTFKLPDNVSFSEAAMVEPFAVGVQAAVKAEIKPGDVGVVTGAGPIGIM
VALAALLGGCSKVYITDLVPEKLAIAGRYANIVPVNVRETSLADVVLKDTEGWGADLVFE
ASGSPKAYEGITEVIRPGGKLVVIGMPVEPVALDMSLFAAKEIRIETVFRYANVFDRALN
MIASGKVDLKPLVTGTYSFDDSIVAFERAEEAHPTDVKLQILF
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccctggttctcgaaaggcagcacgagctgaagctgcgcgacatcgacctgccg
ctcgaggtcggcccggccgacgtgaagatcaagatgcacacggtcggcgtctgcggtagc
gacgtgcattattacacccatggccgcatcggtcccttcatcgtcaaggcgccgatggtg
ctcggccacgaggccgccggcacggtggtcgaggtcggcgcgaaggtgacgaacctcaag
gtcggcgaccgcgtctgcatggagccgggcatcccggacctcgcctccaaggcctccaag
atcggcctctacaatgtcgaccccagcttgactttctgggcgacgccgccggaccatggt
tgcctgacgccttacgtcgtccatccggccgccttcaccttcaagctgccggacaacgtc
tccttctccgaggcggcgatggtcgagcccttcgccgtcggcgtgcaggcggcggtgaag
gccgagatcaagccgggcgacgtcggcgtcgtcaccggcgccgggccgatcggcatcatg
gtggcgctggccgcgctgctgggcggctgctccaaggtctacatcaccgatctcgtgccg
gagaagctggccatcgccggacgctatgccaacatcgtgccggtgaacgtgcgcgagacc
tcgctggccgacgtcgtgctgaaggacaccgagggctggggcgccgacctcgtcttcgag
gcgagcggctcgcccaaagcctatgagggcatcaccgaggtgatccgccccggcggtaag
ctggtggtgatcggcatgccggtggagccagtggcgctcgacatgtcgctcttcgccgcc
aaggagatccgtatcgagaccgtgttccgctatgccaacgttttcgaccgcgcgctgaac
atgatcgcctccggcaaggtcgacctgaagccgctggtcaccggcacctacagcttcgac
gacagcatcgtcgccttcgagcgggcggaggaggcgcatccgaccgacgtgaagcttcag
atcctgttctga

DBGET integrated database retrieval system