KEGG   Starkeya novella: Snov_1428Help
Entry
Snov_1428         CDS       T01258                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
sno  Starkeya novella
Brite
KEGG Orthology (KO) [BR:sno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:sno03012]
    Snov_1428
   03029 Mitochondrial biogenesis [BR:sno03029]
    Snov_1428
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sno04147]
    Snov_1428
Translation factors [BR:sno03012]
 Eukaryotic Type
  Elongation factors
   Snov_1428
 Prokaryotic Type
   Snov_1428
Mitochondrial biogenesis [BR:sno03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Snov_1428
Exosome [BR:sno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Snov_1428
  Exosomal proteins of breast cancer cells
   Snov_1428
  Exosomal proteins of colorectal cancer cells
   Snov_1428
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ADH88738
UniProt: D7A933
LinkDB All DBs
Position
1493649..1494839
Genome map
AA seq 396 aa AA seqDB search
MAKEKFNRSKPHCNIGTIGHVDHGKTSLTAAITKVLAESGGATFTAYDQIDKAPEEKARG
ITISTAHVEYETTNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPALVVFLNKCDMVDDEELLELVELEVRELLSKYDFPGDDIPIIRGSALVALE
NGDPKLGRDAVLKLMEAVDAYIPQPERPIDQPFLMPIEDVFSISGRGTVVTGRVERGIIK
VGDEVEIVGIRPTTKTTVTGVEMFRKLLDQGQAGDNVGILVRGTKREDVERGQVVCKPGS
VKPHTKFKAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGIVTLPEGTEMVMPGDNIT
VDVALIVPIAMEEKLRFAIREGGRTVGAGVVASIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagagaagttcaaccgttcgaagcctcactgcaacattgggacgattggccat
gttgaccatggcaagacgtcgttgacggcggcgatcacgaaggttttggcggagtctggc
ggcgcgacgttcacggcgtatgaccagatcgacaaggcgccggaagagaaggcgcgcggc
atcacgatctcgaccgcgcatgtcgagtacgagacgacgaaccgccactacgcgcacgtc
gactgccccggccacgccgactatgtgaagaacatgatcaccggcgcggcgcagatggac
ggcgcgatcctggtggtgtcggcggcggacggcccgatgccgcagacccgcgagcacatc
ctcctggcgcgccaggtcggcgttccggcgctggtggtgttcctcaacaagtgcgacatg
gtcgacgacgaggaactgcttgagctggtggagctcgaggttcgcgagctgctgtcgaag
tacgacttccccggcgacgacatcccgatcatccgcggctcggcgttggtggcgcttgag
aacggcgatcccaagctcggccgcgacgcggtgctgaagctgatggaagcggtcgacgcc
tacatcccgcagccggagcgtccgatcgaccagcccttcctgatgccgatcgaggacgtg
ttctcgatctcgggccgcggcacggtggtgaccggccgcgtcgagcgcggcatcatcaag
gtgggcgacgaagtcgagatcgtcggcattcgtccgaccaccaagacgacggtgaccggt
gtcgagatgttccgcaagctgctggaccagggccaggcgggcgacaatgtcggcatcctc
gtccgcggcaccaagcgcgaggacgtggagcgcggccaggtggtgtgcaagccgggttcg
gtgaagccgcacaccaagttcaaggccgaggcgtacatcctgacgaaggaggagggtggc
cgtcacacgccgttcttcaccaactatcgtccgcagttctatttccggacgacggacgtg
acgggcatcgtgacgctgccggaaggcacggagatggtgatgccgggcgacaacatcacg
gttgacgtggcgctgatcgttccgatcgcgatggaagagaagctgcgcttcgccatccgc
gagggcggccgcaccgtcggcgccggcgtcgtcgcctccatcatcgagtga

DBGET integrated database retrieval system