KEGG   Starkeya novella: Snov_1810Help
Entry
Snov_1810         CDS       T01258                                 

Definition
(GenBank) CTP synthase
  KO
K01937  CTP synthase [EC:6.3.4.2]
Organism
sno  Starkeya novella
Pathway
sno00240  Pyrimidine metabolism
sno01100  Metabolic pathways
Module
sno_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:sno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Snov_1810
Enzymes [BR:sno01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.2  CTP synthase (glutamine hydrolysing)
     Snov_1810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CTP_synth_N GATase Peptidase_C26
Motif
Other DBs
NCBI-ProteinID: ADH89114
UniProt: D6ZYK2
LinkDB All DBs
Position
complement(1890481..1892109)
Genome map
AA seq 542 aa AA seqDB search
MARYIFITGGVVSSLGKGLASAALGALLQARGYKTRLRKLDPYLNVDPGTMSPYQHGEVF
VTDDGAETDLDLGHYERFTGRPASRQDNITTGRIYQDILAKERRGDYLGATIQVIPHVTN
AIKEFILSGNEGYDFVLVEIGGTVGDIEAMPFLEAIRQVGNELPRKHCIYVHLTLLPFIP
SAGELKTKPTQHSVKELRSIGIAPDILLCRTDREIPREERRKLGLFCNVRESAVIEARDA
DNIYAVPSAYHEAGLDTEVLAAFGIEPAPEPDLSRWKKVEAGIRNPEGAVTIAIVGKYTG
MKDAYKSLIEALAHGGLANNVRVNLDWIESEIFEREDPAPFLEHVHGILVPGGFGQRGAE
GKIRAAQFARERRVPYLGICFGMQMAVIEATRNLAGVENANSTEFGPTDEPVVGLLTEWL
RGNELEKRGIHGDLGGTMRLGAYPASLAEGSRVAEIYDSTEISERHRHRYEVNMAYRERL
EACGMRFSGLSPDGLLPEIIEYPDHPWFVGVQFHPELKSRPFEPHPLFASFIEAAAVQSR
LF
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgctatattttcatcaccggcggcgtcgtgtcctcgctcggcaagggcctcgct
tccgccgctctcggtgcattgctgcaggcccgtggttacaagacccggctgcgcaagctc
gacccctacctcaacgtcgatcctggcacgatgagcccgtatcagcacggcgaggtgttc
gtcaccgacgacggggccgagaccgatctcgacctcgggcactacgagcggttcaccggc
cgtccggcctcgcggcaggacaacatcacgaccgggcgcatctaccaggacatcctcgcc
aaggaacggcgcggcgactatctcggcgccaccatccaggtgatcccgcacgtcaccaac
gccatcaaggaattcatcctctccggcaacgagggctacgacttcgtgctggtggagatc
ggcggcacggtcggcgacatcgaggccatgcccttcctcgaggcgatccgccaggtcggc
aacgagctgccgcgcaagcactgcatctatgtccacctgaccctgctgcccttcatcccc
tcggccggcgagctcaagaccaagccgacgcagcactcggtgaaggagctgcgctccatc
ggcatcgcgcccgacatcctgctctgccgcaccgaccgcgagattccgcgcgaggagcgc
cgcaagctcggcctgttctgcaatgtgcgcgagagcgcggtgatcgaggcgcgcgacgcc
gacaacatctatgcggtgccttccgcctatcacgaggcggggctggacaccgaggtgctc
gcggccttcggcatcgagccggcgcccgagccggacctctcgcgctggaagaaggtcgag
gccggcatccgcaacccggaaggggcggtgacgatcgccatcgtcggcaagtacacgggc
atgaaggacgcctacaagtccctcatcgaggcgctggcccatggcggcctcgccaacaat
gtccgggtcaatctcgactggatcgagagcgagatcttcgagcgcgaggaccccgcgccc
ttcctggagcatgtccacggcatcctcgtgccgggcggcttcggccagcgcggcgccgag
ggcaagatccgcgcggcgcagttcgcccgcgagcggcgcgtgccctatctcggcatctgc
ttcggcatgcagatggcggtgatcgaggcgacgcggaaccttgccggcgtcgagaacgcc
aattccaccgaatttggcccgaccgatgagccggtggtcggcctgctgaccgaatggctg
cgcggcaacgagcttgagaagcgcggcatccatggcgatctcggcggcaccatgcgcctc
ggcgcctatccggcgagcctcgccgaaggcagccgggtggcggaaatctacgattcgacg
gagatttccgagcgccaccgccaccgctacgaggtcaacatggcctatcgcgagcggctg
gaggcctgcggcatgcgcttctccggcctgtcgccggacgggctgctgccggagatcatc
gaatatccggaccatccctggttcgtcggcgtgcagttccacccggagctgaagtcgcgc
cccttcgagccgcacccgctcttcgcttccttcatcgaagccgccgcggtgcagagccgg
ctgttctga

DBGET integrated database retrieval system