KEGG   Starkeya novella: Snov_2415Help
Entry
Snov_2415         CDS       T01258                                 

Definition
(GenBank) Aldehyde dehydrogenase (NAD(+))
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
sno  Starkeya novella
Pathway
sno00010  Glycolysis / Gluconeogenesis
sno00620  Pyruvate metabolism
sno01100  Metabolic pathways
sno01110  Biosynthesis of secondary metabolites
sno01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Snov_2415
   00620 Pyruvate metabolism
    Snov_2415
Enzymes [BR:sno01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     Snov_2415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA LuxC
Motif
Other DBs
NCBI-ProteinID: ADH89710
UniProt: D7A3F1
LinkDB All DBs
Position
2531960..2533477
Genome map
AA seq 505 aa AA seqDB search
MNKPELSITKQSPFKARYGNFIGGQFVEPVNGRYFDNTSPITGGKICEVARSDKDDIEKA
LDAAHAAKDAWGKTSAAERALILNKVADRMEENLDLLALAETWDNGKPIRETTAADIPLA
IDHFRYFAACVRAQEGNLSEIDHDTIAYHFHEPLGVVGQIIPWNFPILMAVWKLAPALAA
GNCVVLKPAEQTPSSVLVLAELVADLLPPGVLNIVNGYGLEAGKPLASNPRIAKIAFTGE
TTTGRLIMQYASQNLIPVTLELGGKSPNIFFGDVVAEDDDFFDKAVEGFVMFALNQGEVC
TCPSRALIQESVYDRFMEKALKRVEDIVQGSPLDPSTMIGAQASSEQLDKILSYIDIGKQ
EGAQVLTGGERNNLGGDLAGGYYVKPTVFKGHNRMRIFQEEIFGPVVSVTTFKDDEEALS
IANDTLYGLGAGVWTRDGNRAYRFGRAIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRETH
KMMLDHYQQTKNLLVSYSPKKLGFF
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagccagaactctccattaccaagcagtcgcctttcaaagcccgctacggcaac
ttcatcggcggccagttcgtcgagccggtgaacgggcgctatttcgacaacacttcgccc
atcacgggcggcaagatctgcgaggtcgcccgctcggacaaggacgacatcgagaaggcg
ctcgacgcggcccacgccgccaaggatgcctggggcaagacctcggccgccgagcgcgcg
ctgatcctcaacaaggtcgccgaccgcatggaggagaatctcgacctgctcgcgctggcc
gagacctgggacaacggcaagccgatccgcgagaccacggccgccgacatcccgctcgcc
atcgaccatttccgctatttcgccgcctgcgtccgcgcgcaggagggcaacctctccgag
atcgaccacgacaccatcgcctatcacttccacgagccgctcggcgtggtcgggcagatc
atcccgtggaacttcccgatcctgatggcggtgtggaagctcgctcccgcgctcgccgcc
ggcaactgcgtggtgctcaagcccgccgagcagacgccctccagcgtgctggtgcttgcc
gagctggtggccgacctgctgccgcccggcgtgctgaacatcgtcaacggctatggcctg
gaagcgggcaagccgctcgcctccaacccgcgcatcgccaagatcgccttcaccggcgag
acgacgacgggccggctgatcatgcagtacgccagccagaacctgatcccggtgacgctg
gagctcggcggcaagtcgccgaacatcttcttcggcgatgtggtggccgaggacgacgac
ttcttcgacaaggcggtcgagggcttcgtcatgttcgcgctgaaccagggcgaggtctgc
acctgccccagccgcgccctgatccaggaaagcgtctatgaccgcttcatggagaaggcg
ctgaagcgcgtcgaggacatcgtgcagggctccccgctcgatccctccaccatgatcggc
gcgcaggcctcctccgagcagctcgacaagatcctgtcctatatcgacatcggcaagcag
gagggcgcgcaggtgctcaccggcggcgagcgcaacaatctcggcggcgacctcgccggc
ggctattacgtcaagccgaccgtgttcaagggccacaaccggatgcggatcttccaggaa
gagatcttcggcccggtggtctcggtgaccacgttcaaggacgacgaggaggcgctctcc
atcgccaatgacacgctctacggcttaggggccggcgtgtggacccgcgacggcaaccgc
gcctatcgcttcggccgcgccatccaggcgggccgcgtctggaccaactgctaccacgcc
tacccggcccatgcggccttcggcggctacaagcagtccggcatcgggcgcgagacccac
aagatgatgctcgaccactaccagcagaccaagaacctgctggtcagctacagcccgaag
aagctcggcttcttctga

DBGET integrated database retrieval system