KEGG   Starkeya novella: Snov_2431Help
Entry
Snov_2431         CDS       T01258                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sno  Starkeya novella
Pathway
sno00620  Pyruvate metabolism
sno00680  Methane metabolism
sno00710  Carbon fixation in photosynthetic organisms
sno01100  Metabolic pathways
sno01120  Microbial metabolism in diverse environments
sno01200  Carbon metabolism
Module
sno_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Snov_2431
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Snov_2431
   00680 Methane metabolism
    Snov_2431
Enzymes [BR:sno01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Snov_2431
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 PEP-utilisers_N
Motif
Other DBs
NCBI-ProteinID: ADH89726
UniProt: D7A3G7
LinkDB All DBs
Position
complement(2550142..2552928)
Genome map
AA seq 928 aa AA seqDB search
MSVALTIALPDAELDADGELDLSLRDDIRMLGRVLGDTLRDQEGEPTFELVERIRRVSTR
FHREEDEGARHELEAILNQLDPEQTVTIVRAFSYFSHLANIAEDQNVIRRMRAAAAAGNG
GPPSVARAIEKARAHGVSSAELRGFFDTALASPVLTAHPTEVRRRSTLTHEMCIAELLAD
RARLDPTPEEQELADDELRRRVLMLWQTNLLRRTKLTVLDEVANGLAYYDYTFLRQLPKL
YAAVEDRLAALDGSGEASELASFLRIGSWIGGDRDGNPFVTADVTRETLRMQSAQAVRFY
LEELDALGGELSISTIRVKVSGELMGLVDASSDGSPHRRNEPYRLATGVITTRLRATAFR
LEIADLLGITEKPAAAPYASAQELRADLDIIDRSLRTHGSSAIARGKLRALRRAVDCFGF
HLAVLDSRQNSDVHERCVAELFEVAAPGTDYKGLPEGTRVALLLRELATARPLTSPFVAY
SDETVGEMAMLRTCARIHQIYGPEAIQTCIISKAEGVSDMLELALLLKEVGLVDPAGTAA
VNIVPLFETIEDLRNAARVMEQMFRLPEYRKLVDSRGGVQEVMLGYSDSNKDGGFVTSGW
ELYKAEIELIEVFKRHGVRLRLFHGRGGSVGRGGGPSYDAILAQPGGAVQGQIRITEQGE
IISSKYSNPAVGRGNLEILAAATMEATLLSGDAKAPREEYLSVMEKISDAAFKAYRALVY
ETPRFEDYFWESTVINEIATLNIGSRPASRKKTRRVEDLRAIPWVFSWAQCRLMLPGWYG
FGTAVGEWLKANPDGLPLLQEMYREWPFFRTQLSNMDMVLSKSSIAIASRYAELVEDVEL
RESIFGRIRAEHQAAIDALLSIAQQPKLLGSNPLLDRSIRARFPYIDPLNHVQVGLLRAY
RGNDTDEKVLQGIQLTINGISAGLRNSG
NT seq 2787 nt NT seq  +upstreamnt  +downstreamnt
atgtccgttgccctcaccatcgccctgcccgatgccgagctcgatgccgacggcgaactc
gacctgtcgctgcgcgacgacatccgcatgctgggccgggtgctgggcgacacgctgcgc
gaccaggagggcgagccgaccttcgaactggtggagcgcatccgccgcgtctccacccgc
ttccaccgcgaggaggacgagggcgcccggcacgagctggaggcgatcctgaaccagctc
gaccccgagcagaccgtcaccatcgtccgggctttctcctatttctcccacctcgccaac
atcgccgaggaccagaacgtcatccgccgcatgcgcgcggcggcggcggccggcaatggc
ggtccgcccagcgtggcccgggcgatcgagaaggcacgcgcgcatggcgtctcgtccgcc
gagctgcgcggcttctttgataccgcgctggcgagcccggtgctcaccgcccacccgacc
gaggtgcgccgccgctcgacgctgacgcatgagatgtgcatcgccgagctgctggccgac
cgcgcccggctcgacccgacgccggaggagcaggagctcgccgacgacgagctgcgccgc
cgcgtgctgatgctgtggcagaccaacctgctgcgccggaccaagctgacggtgctggac
gaggtggcgaacgggctcgcctattacgactacaccttcctgcgccagctgccgaagctc
tatgcggcggtggaggaccggctcgccgcgctcgacggcagcggcgaggcttccgaactc
gcctccttcctgcgcatcggcagctggatcggcggcgaccgcgacggcaaccccttcgtc
accgccgacgtcacccgcgagacgctgcgcatgcagagcgcgcaggcggtgcgcttctat
ctggaggagctcgacgcgctcggcggcgaactctcgatcagcaccatccgggtgaaggtc
tccggcgagctgatggggctggtcgacgcctcctcggacggctcgccgcaccggcgcaac
gagccctaccgcctcgccaccggcgtcatcactacgaggctgcgcgccaccgccttccgg
ctggagatcgccgacctgctcggcatcaccgagaagccggcggcggcgccctatgcctcc
gcccaggaattgcgagccgacctcgacatcatcgaccgctcgctgcgcacgcacggctcc
agcgccatcgcgcggggcaagctgcgggcgctgcgtcgggcggtcgattgcttcggcttc
catctcgcggtgctggattcccgccagaactcggacgtccacgagcgctgcgtcgccgag
ctgttcgaggtcgccgcccccggcaccgactacaagggcctgccggagggcacgcgcgtc
gccctgctgctgcgcgaactcgccaccgcgcgcccgctcacctcgcccttcgtcgcctat
tccgacgagacggtgggggagatggcgatgctgcgcacctgcgcccgcatccaccagatc
tacggccccgaggcgatccagacctgcatcatctccaaggccgagggcgtctcggacatg
ctggagctggcgctgctgctcaaggaggtcggcctcgtcgatcccgccggtacggcggcg
gtgaacatcgtgccgctgttcgagaccatcgaggacctgcgcaacgccgccagggtgatg
gagcagatgttccgcctgccggaataccgcaagctggtcgacagccgcggcggcgtgcag
gaggtgatgctcggctattccgacagcaacaaggatggcggcttcgtcacctccggctgg
gagctctacaaggccgagatcgagctgatcgaggtgttcaagcgccacggcgtgcggctg
cggctgttccacggccgcggcggctcggtcggccgcggcggcgggccgagctacgatgcc
atcctcgcccagccgggcggggcggtgcaggggcagatccgcatcaccgagcagggcgag
atcatctcgtccaagtactccaacccggcggtcgggcgcggcaacctcgaaatcctcgcc
gccgcgaccatggaggcgacgctgctctccggcgacgccaaggcgccgcgcgaggaatat
ctgtcggtgatggagaagatctccgacgcggcgttcaaggcctatcgggcgctggtctac
gagaccccgcgcttcgaggattatttctgggaatccaccgtcatcaacgagatcgcgacg
ctgaacatcggctcgcgcccggcctcgcgcaagaagacgcggcgggtggaggacctgcgc
gcgatcccgtgggtgttctcctgggcgcagtgccggctgatgctgccgggctggtacggc
ttcggtacggcggtgggcgaatggctgaaggccaatcccgacggcctgccgctcttgcag
gagatgtaccgcgagtggccgttcttccgcacacagctctccaacatggacatggtgctg
tcgaagagctccatcgccatcgcctcgcgctatgccgagctggtggaggacgtggagctg
cgcgagagcatcttcgggcgcatccgcgccgagcatcaggcggcgatcgacgcgctgctg
tcgattgcgcagcagccgaagctgctgggttcgaacccgctgctcgaccgctccatccgc
gcgcgcttcccctatatcgacccgctgaaccatgtgcaggtcggcctgctgcgcgcctat
cgcggcaacgacaccgacgagaaggtgctgcaggggatacagctgacgatcaacggcatc
tcggcaggactgcgcaactcggggtaa

DBGET integrated database retrieval system