KEGG   Starkeya novella: Snov_3661Help
Entry
Snov_3661         CDS       T01258                                 

Definition
(GenBank) Ribulose-bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
sno  Starkeya novella
Pathway
sno00630  Glyoxylate and dicarboxylate metabolism
sno00710  Carbon fixation in photosynthetic organisms
sno01100  Metabolic pathways
sno01120  Microbial metabolism in diverse environments
sno01200  Carbon metabolism
Module
sno_M00165  Reductive pentose phosphate cycle (Calvin cycle)
sno_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:sno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Snov_3661
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Snov_3661
Enzymes [BR:sno01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Snov_3661
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ADH90931
UniProt: D7AAR4
LinkDB All DBs
Position
3864329..3865591
Genome map
AA seq 420 aa AA seqDB search
MPPLSRIEADYLIETAYDPRAAAEAMAGEQSSGTFVPVPGETPELKERSAARIEALEIVD
TVEAPSLPGAGHPKGEAPIRRARVTLSWPLDNLGPSLPNLMATVAGNLFELKQFSGLRLL
DIRLPHAFADAYGGPKFGVAGTRRLAGVEGRPLIGTIVKPSVGFGPQETADLVELLAEGG
IDFVKDDELQSDGPHCPFEERVRAVMRVVNDHADRTGRKVMFAFNITGELDQMRRRHDVV
LQHGGTCVMASLNSVGLVGMVELGRFTELPIHAHRNGWGYLSRAPMLGWSYVAWQKIWRL
AGADHMHVNGLSNKFSEADDSVIASARECLTPLFEDKPCIAMPVFSSGQSAKQAPGTYAA
LGSPDLIFAAGGGIMAHPDGPAAGVASLREAWEAAMASVPLADYARDHTALARALETYAV
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgcccccgctgtcacgcatcgaggccgactacctcatcgaaaccgcctacgacccgcgc
gccgcagccgaggcgatggccggcgagcagtcgagcgggaccttcgtgccggtacccggc
gagacgcccgagctgaaggagcgctccgccgcccgcatcgaggcgctggagatcgtcgac
accgtcgaggcgccgtcgctgccgggggccggccatcccaagggcgaagcgccgatccgc
cgcgcccgcgtcacgctttcctggccgctcgacaatctcggcccctcgctgccgaacctg
atggcgacggtcgccggcaacctgttcgaactcaagcagttctccgggctgcgcctgctg
gacatccgcctgccgcacgccttcgccgacgcctatggcgggccgaaattcggcgtcgcc
ggcacgcgccgcctcgccggtgtcgaaggccgtccgctcatcggcaccatcgtcaagcca
agcgtcggcttcggcccacaggagacggcggacctcgtggagcttctcgccgagggcggc
atcgacttcgtcaaggacgacgaattgcagtccgacggcccgcattgcccgttcgaggaa
cgggtgcgggcggtgatgcgcgttgtcaacgaccatgccgaccgcaccggccgcaaggtg
atgttcgccttcaacatcaccggcgagctcgaccagatgcgccggcgccacgatgtggtc
ctgcagcacggcggcacctgcgtgatggcgagcctcaactcggtcggtctcgtcggcatg
gtcgagctcggccgcttcaccgagctgccgatccacgcccatcgcaacggctggggctat
ctctcccgcgcgccgatgctgggctggtcctatgtcgcctggcagaagatctggcgcctg
gccggcgccgaccacatgcacgtcaacggcctctccaacaagttctcggaagccgacgac
agcgtcatcgcctcggcgcgcgaatgcctgacgccgctgttcgaggacaagccgtgcatc
gccatgccggtcttctcctccggccagtcggccaagcaggcgccgggcacctatgccgcg
ctcggctcgcccgatctcatcttcgccgccggcggcggcatcatggctcatcccgacggc
ccggcggcgggcgtcgcctcgctgcgggaggcgtgggaggcggccatggcaagcgtgccg
ctcgccgattacgcccgcgaccacaccgccctcgcccgagccctggagacctacgcggta
tga

DBGET integrated database retrieval system