KEGG   Streptococcus pneumoniae AP200 (serotype 11A): SPAP_1052Help
Entry
SPAP_1052         CDS       T01309                                 

Definition
(GenBank) Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component,-like enzyme
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
snp  Streptococcus pneumoniae AP200 (serotype 11A)
Pathway
snp00010  Glycolysis / Gluconeogenesis
snp00020  Citrate cycle (TCA cycle)
snp00620  Pyruvate metabolism
snp01100  Metabolic pathways
snp01110  Biosynthesis of secondary metabolites
snp01120  Microbial metabolism in diverse environments
snp01130  Biosynthesis of antibiotics
snp01200  Carbon metabolism
Module
snp_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:snp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPAP_1052
   00020 Citrate cycle (TCA cycle)
    SPAP_1052
   00620 Pyruvate metabolism
    SPAP_1052
Enzymes [BR:snp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SPAP_1052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding AATase
Motif
Other DBs
NCBI-ProteinID: ADM84641
LinkDB All DBs
Position
989831..990874
Genome map
AA seq 347 aa AA seqDB search
MADDKLRATPAARKLADDLGINLYDVSGSGANGRVHKEDVETYKDTNVVRISPLAKRIAL
EHNIAWQEIQGTGHRGKIMKKDVLALLPENIENDSIKSPAQIEKVEEVPDNVTPYGEIER
IPMTPMRKVIAQRMVESYLTAPTFTLNYEVDMTEMLALRKKVLEPIMEATGKKTTVTDLL
SLAVVKTLMKHPYINASLTEDGKTIITHNYVNLAMAVGMDNGLMTPVVYNAEKMSLSELV
VAFKDVIGRTLDGKLAPSELQNSTFTISNLGMFGVQSFGPIINQPNSAILGVSSTIEKPV
VVNGEIVIRPIMSLGLTIDHRVVDGMAGAKFMKDLKELIETPISMLI
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggctgatgacaagctaagagcgactcctgcagctagaaagttagcggatgatttaggg
ataaacctctacgacgtttctggctcaggtgcaaacggtcgtgtccacaaagaagacgtg
gaaacttataaagacacaaacgtggttcgcatttcgccacttgcaaaacgaattgccctc
gaacataacattgcttggcaggaaatccaaggaaccggtcatcgtggtaaaatcatgaag
aaggatgttttggccctgcttcctgaaaatatcgaaaacgatagcatcaaatctcctgct
cagattgaaaaagtggaagaagtccctgataacgtaacaccatatggtgaaatcgagcgt
attccaatgacaccaatgcgtaaggttattgcccaacgcatggttgaatcttacttgact
gcgccaaccttcaccctcaactatgaagttgatatgactgaaatgttggctcttcgtaag
aaggttcttgagccaatcatggaagcaactgggaagaagactactgtaacagaccttctt
tcgcttgcagttgttaagactcttatgaaacacccatacatcaatgcttcattgacagaa
gatggcaagactattatcactcacaactatgtcaatcttgccatggcagttgggatggat
aatggattgatgacacctgttgtttacaatgctgagaagatgagtctttcagaactggtt
gtagcctttaaggatgttattggccgtaccttggatggtaaattggctccaagtgagtta
caaaattcaacattcacaatcagtaatttgggaatgtttggtgttcagtcctttggcccg
attattaaccaacccaactcagctatccttggtgtcagttcgacaatcgagaagccagtt
gtcgtcaatggtgaaattgtgattcgcccaatcatgagtttaggattaaccattgaccac
cgtgtcgtagatggtatggctggtgctaagtttatgaaggacttgaaagagttgattgaa
accccaatctcaatgttgatttaa

DBGET integrated database retrieval system