KEGG   Streptococcus pneumoniae AP200: SPAP_1180Help
Entry
SPAP_1180         CDS       T01309                                 

Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
snp  Streptococcus pneumoniae AP200
Pathway
snp00240  Pyrimidine metabolism
snp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:snp00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SPAP_1180
Enzymes [BR:snp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     SPAP_1180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30 KdpD
Motif
Other DBs
NCBI-ProteinID: ADM84769
LinkDB All DBs
Position
complement(1117831..1118430)
Genome map
AA seq 199 aa AA seqDB search
MAQLYYRYGTMNSGKTIEILKVAYNYEEQGKGVVIMTSALDTRDGVGYVSSRIGMKRPAL
TIEETTDIFGYIRDLPEKPYCVLVDEAQFLKRHHVYDLARVVDELDIPVMAFGLKNDFRN
ELFEGSKYLLLLADKIDEIKTICQYCKKKATMVLRTQDGLPVYDGEQIQIGGNETYISVC
RKHYFAPMITSNKEQNYDN
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggcacagttgtattatcgttatgggaccatgaactctggtaaaacgattgagattctc
aaagtggcctataactacgaggagcaaggaaaaggtgttgtcattatgacttcggctctg
gatacgcgtgacggtgttggctatgtgtcgagtcgaattggcatgaaacgccctgccctt
acgattgaggaaacaacggatatctttggctatatccgagacctaccagaaaaaccttac
tgtgttttggtcgatgaagcccagtttctcaaacgccaccatgtttacgacctagctcgt
gttgtggacgagttagacatacccgtcatggcttttggcttgaaaaatgactttcgcaat
gaattgttcgaaggttccaaatatctcttgcttttagcagacaagattgacgaaatcaag
accatctgtcagtattgcaagaaaaaggcgaccatggtgttgcgaacacaggatggactg
cccgtttacgatggagaacagatccagattggtggtaatgaaacctatatttcggtttgc
cgtaaacattattttgcgccaatgataacctctaacaaggagcaaaactatgacaattga

DBGET integrated database retrieval system