KEGG   Streptococcus pneumoniae AP200 (serotype 11A): SPAP_1412Help
Entry
SPAP_1412         CDS       T01309                                 

Definition
(GenBank) Glycosidase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
snp  Streptococcus pneumoniae AP200 (serotype 11A)
Pathway
snp00500  Starch and sucrose metabolism
snp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:snp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SPAP_1412
Enzymes [BR:snp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     SPAP_1412
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF1939 Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: ADM84998
LinkDB All DBs
Position
1333473..1334927
Genome map
AA seq 484 aa AA seqDB search
MQNQTLMQYFEWYLPHDGQHWTRLAENAPHLAHLGISHVWMPPAFKATNEKDVGYGVYDL
FDLGEFNQKGTVRTKYGFKEDYLQAIQALKAQGIQPMADVVLNHKAAADHREAFQVIEVD
PVDRTVELGEPFTINGWTSFTFDGRQDTYNDFHWHWYHFTGTDYDAKRRKSGIYLIQGDN
KGWANEELVDNENGNYDYLMYADLDFKHPEVIQNIYDWADWFMETTGVAGFRLDAVKHID
SFFMRNFIRDMKEKYGDDFYVFGEFWNPDKEANLNYLEKTEEHFDLVDVRLHQNLFEASQ
AGANYDLRGIFTDSLVELKPDKAVTFIDNHDTQRGQALESTVEEWFKPAAYALILLRQDG
LPCVFYGDYYGISGQYAQEDFKEILDRLLAIRKDLAYGEQNDYFDHANCIGWVRSGAENQ
SPIAVLISNDQENSKSMFVGQEWTNQTFVDLLGNHQGQVTIDEEGYGQFPVSARSVSVWA
VNTI
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatcaaacactcatgcaatactttgaatggtatctgccccacgacggtcaacac
tggacgcgtctggctgaaaatgctccacacctagctcatctggggatcagtcacgtctgg
atgccaccagccttcaaggcaaccaacgaaaaagatgtcggctatggggtctatgactta
tttgacttaggagagttcaaccaaaaagggactgtccgcaccaagtatggtttcaaagaa
gactatcttcaagccattcaagcccttaaagcgcagggaattcaacctatggccgatgta
gttctcaaccacaaggctgctgctgatcacagggaagcctttcaggttattgaagtggat
cctgtagaccgtacagttgaacttggagaacccttcaccatcaatggctggactagtttt
accttcgatggtcgccaagatacctacaatgacttccactggcactggtaccacttcaca
ggtacagactatgatgccaaacgccgtaaatccgggatttacctaatccaaggagacaac
aagggctgggctaacgaggaattggtcgataacgaaaacggaaactacgactacctcatg
tatgccgacctagactttaaacatcctgaagtcatccaaaacatctatgactgggctgat
tggttcatggaaacgactggtgtagctggtttccgtttggatgccgttaagcatattgac
tctttctttatgcgcaatttcatccgcgatatgaaggaaaaatacggtgacgatttctat
gtttttggtgaattttggaacccagacaaggaagccaatctgaactatctcgaaaaaacg
gaagaacactttgaccttgtcgatgttcgtctccaccagaatctctttgaagccagtcaa
gctggcgcaaactatgaccttcgtggtattttcacagatagcctggttgaactcaagcct
gacaaggctgtgacttttatcgacaaccacgatacccaacgaggacaagcccttgagtct
accgttgaagaatggttcaagccagcagcctatgccctcattttgttacgccaagacggc
cttccatgtgtcttttacggagactactatgggatttcaggccagtatgctcaagaagat
ttcaaagaaatccttgaccgcctcctagccatccgaaaagacttggcctatggagaacaa
aatgactactttgaccatgctaactgtatcggttgggtacgttcaggtgctgaaaatcaa
tccccaatcgcagtccttatctcaaatgaccaagaaaacagcaagtcaatgtttgtcggt
caagaatggactaatcaaacctttgtagatttacttggtaaccaccaaggtcaagttaca
attgatgaggaaggttatggacaattccctgtctcagctagatccgtaagtgtctgggca
gtcaataccatctaa

DBGET integrated database retrieval system