KEGG   Streptococcus pneumoniae AP200: SPAP_1460Help
Entry
SPAP_1460         CDS       T01309                                 

Definition
(GenBank) hypothetical protein
Organism
snp  Streptococcus pneumoniae AP200
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RE_ApaLI
Motif
Other DBs
NCBI-ProteinID: ADM85046
LinkDB All DBs
Position
1377082..1377231
Genome map
AA seq 49 aa AA seqDB search
MANDNKSHYLIYRVLGISFEEGENIDLYQNKGRFLYKYAGSFLEEAAVL
NT seq 150 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatgataataagagccattatttgatatacagagttttaggtatttcatttgaa
gaaggagaaaatatcgatttgtatcaaaataaaggtcgttttttatacaaatatgctggt
tcatttttagaagaagctgcagtactatga

DBGET integrated database retrieval system