KEGG   Streptococcus pneumoniae AP200 (serotype 11A): SPAP_1737Help
Entry
SPAP_1737         CDS       T01309                                 

Definition
(GenBank) Serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
snp  Streptococcus pneumoniae AP200 (serotype 11A)
Brite
KEGG Orthology (KO) [BR:snp00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:snp01001]
    SPAP_1737
Enzymes [BR:snp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     SPAP_1737
Protein kinases [BR:snp01001]
 Serine/threonine kinases: Other
  Bacterial family
   SPAP_1737
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Kinase-like RIO1 Kdo Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: ADM85321
LinkDB All DBs
Structure
PDB: 

Position
complement(1642833..1644812)
Genome map
AA seq 659 aa AA seqDB search
MIQIGKIFAGRYRIVKQIGRGGMADVYLAKDLILDGEEVAVKVLRTNYQTDPIAVARFQR
EARAMADLDHPHIVRITDIGEEDGQQYLAMEYVAGLDLKRYIKEHYPLSNEEAVRIMGQI
LLAMRLAHTRGIVHRDLKPQNILLTPDGTAKVTDFGIAVAFAETSLTQTNSMLGSVHYLS
PEQARGSKATVQSDIYAMGIIFYEMLTGHIPYDGDSAVTIALQHFQKPLPSVIAENPSVP
QALENVIIKATAKKLTNRYRSVSEMYVDLSSSLSYNRRNESKLIFDETSKADTKTLPKVS
QSTLTSIPKVQAQTEHKSIKNPSQAVTEETYQPQAPKKHRFKMRYLILLASLVLVAASLI
WILSRTPATIAIPDVAGQTVAEAKATLKKANFEIGEEKTEASEKVEEGRIIRTDPGAGTG
RKEGTKINLVVSSGKQSFQISNYVGRKSSDVIAELKEKKVPDNLIKIEEEESNESEAGTV
LKQSLPEGTTYDLSKATQIVLTVAKKATTIQLGNYIGRNSTEVISELKQKKVPENLIKIE
EEESSESEPGTIMKQSPGAGTTYDVSKPTQIVLTVAKKVTSVAMPSYIGSSLEFTKNNLI
QIVGIKEANIEVVEVTTAPAGSVEGMVVEQSPRAGEKVDLNKTRVKISIYKPKTTSATP
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgatccaaatcggcaagatttttgccggacgctatcggattgtcaaacagattggtcga
ggaggcatggcggatgtctacctagccaaagacttaatcttagatggggaagaagtggca
gtgaaggttctgaggaccaactaccagacggacccgatagctgtagctcgttttcagcgt
gaagcgagagctatggcagatctagaccatcctcatatcgttcggataacagatattggt
gaggaagacggtcaacagtatcttgcaatggagtatgttgctggactagacctcaaacgc
tatatcaaggaacattatcctctttctaatgaagaagcagtccgtatcatgggacaaatt
ctcttggctatgcgcttggcccatactcgaggaattgttcacagggacttgaaacctcaa
aatatccttttgacaccagatgggacggccaaggtcacagactttgggattgctgtagcc
tttgcagagacaagtctgacccagactaactcgatgttgggctcagttcattacttgtca
ccagagcaggcgcgtggttcgaaggcgactgtgcagagtgatatctatgccatggggatt
attttctatgagatgttgacaggccatatcccttatgacggggatagcgcggtgaccatt
gccctccagcatttccagaaacccctgccgtccgttattgcagaaaatccatctgtacct
caggctttagaaaatgttattatcaaggcaactgctaaaaagttgaccaatcgctaccgc
tcggtttcagagatgtatgtggacttgtctagtagcttgtcctacaatcgtagaaatgaa
agtaagttaatctttgatgaaacgagcaaggcagataccaagaccttgccgaaggtttct
cagagtaccttgacatctattcctaaggttcaagcgcagacagaacacaaatcaatcaaa
aacccaagccaggctgtgacagaggaaacttaccaaccacaagcaccgaaaaaacataga
tttaagatgcgttacctgattttgttggccagccttgtattggtggcagcttctcttatt
tggatactatccagaactcctgcaaccattgccattccagatgtggcaggtcagacagtt
gcagaggccaaggcaacgctcaaaaaagccaattttgagattggtgaggagaagacagag
gctagtgaaaaggtggaagaagggcggattatccgtacagatcctggcgctggaactggt
cgaaaagaaggaacgaaaatcaatctggttgtctcatcaggcaaacaatccttccaaatt
agtaattatgtcggccggaaatcttctgatgttatcgcggaattaaaagagaaaaaagtt
ccagataatttgattaaaattgaggaagaagagtcgaatgagagtgaggctggaacggtc
ctgaagcaaagtctaccagaaggtacgacctatgacttgagtaaggcaactcaaattgtt
ttgacagtagctaaaaaagctacgacgattcaattagggaactatattggacggaactct
acagaagtaatctcagaactcaagcagaagaaggttcctgagaatttgattaagatagag
gaagaagagtccagcgaaagcgaaccaggaacgattatgaaacaaagtccaggtgccgga
acgacttatgatgtgagtaaacctactcaaattgtcttgacagtagctaaaaaagttaca
agtgttgccatgccgagttacattggttccagcttggagtttactaagaacaatttgatt
caaattgttgggattaaggaagctaatatagaagttgtagaagtgacgacagcgcctgca
ggtagtgtagaaggcatggttgttgaacaaagtcctagagcaggtgaaaaggtagaccta
aataagactagagtcaagatttcaatctacaaacctaaaacaacttcagctactccttaa

DBGET integrated database retrieval system