KEGG   Streptococcus pneumoniae AP200 (serotype 11A): SPAP_2006Help
Entry
SPAP_2006         CDS       T01309                                 

Definition
(GenBank) Aspartate/tyrosine/aromatic aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
snp  Streptococcus pneumoniae AP200 (serotype 11A)
Pathway
snp00220  Arginine biosynthesis
snp00250  Alanine, aspartate and glutamate metabolism
snp00290  Valine, leucine and isoleucine biosynthesis
snp01100  Metabolic pathways
snp01110  Biosynthesis of secondary metabolites
snp01130  Biosynthesis of antibiotics
snp01210  2-Oxocarboxylic acid metabolism
snp01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:snp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SPAP_2006
   00290 Valine, leucine and isoleucine biosynthesis
    SPAP_2006
   00220 Arginine biosynthesis
    SPAP_2006
Enzymes [BR:snp01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     SPAP_2006
    2.6.1.66  valine---pyruvate transaminase
     SPAP_2006
Amino acid related enzymes [BR:snp01007]
 Aminotransferase (transaminase)
  Class I
   SPAP_2006
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1 MHC_II_alpha
Motif
Other DBs
NCBI-ProteinID: ADM85568
LinkDB All DBs
Position
complement(1873114..1874328)
Genome map
AA seq 404 aa AA seqDB search
MKEYNKSSKLEHVAYDIRGPVLEEAMRMRANGEKILRLNTGNPAEFGFTAPDEVIHDLIM
NARDSEGYSDSKGIFSARKAIMQYCQLKKFPNVDIDDIYLGNGVSELIVMSMQGLLDNGD
EVLVPMPDYPLWTAAVSLAGGNAVHYICDEAVEWYPDIDDIKSKITSNTKAIVLINPNNP
TGALYPKKLLLEIIEIARQNDLIIFADEIYDRMVMDGHVHTPVASLAPDVFCVSMNGLSK
SHRIAGFRVGWMVLSGPKTHVKGYIEGLNMLSNMRLCSNVLAQQVVQTSLGGHQSVDELL
LPGGRIYEQRNFIYNAIQDIPGLSAVKPKAGLYIFPKIDRNMYRIDDDEQFVLDFLKQEK
VLLVHGRGFNWQEPDHFRIVYLPRVDELAQIQEKMTRFLKQYRR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaatataacaagtctagtaagttagagcatgttgcttatgatatccgtggtcct
gtattggaagaagccatgcggatgcgagcgaatggagaaaagattttacgtctgaataca
ggaaatccagcagaatttggctttacagcgccagacgaggtcattcatgacttgattatg
aatgcgcgtgatagtgaaggctattctgactccaaaggaattttctcagcccgtaaggcc
atcatgcagtattgccagctgaagaaattcccaaacgtagatattgatgatatttacctt
ggaaatggtgtcagtgagttgattgtcatgtccatgcaggggcttttggacaatggggat
gaggtcttagtgccaatgccagactatcctctatggacggcggctgtcagcctagctgga
ggaaatgccgttcactatatctgtgatgaagctgttgaatggtacccagatattgacgat
atcaagtcaaaaatcacttccaataccaaggcaatcgtccttatcaatccaaataaccca
actggagccctttatcctaagaaactcttgctggagattattgagattgcccgtcaaaac
gatttgattatctttgcggatgaaatctatgaccgcatggtaatggacggacatgtgcat
acgcctgtggcgagcttggcaccagatgtcttctgtgtcagcatgaatggtctgtcaaaa
tcccaccgcatagcaggtttccgtgtgggttggatggtcttgtctggccctaagactcat
gttaagggctatatcgaagggctcaatatgctgtccaatatgcgcctttgctctaacgtt
ttggcccaacaagtcgtacaaacttccttggggggtcaccaatcagtcgatgaattgctt
cttcctggtggacgaatctacgagcaaagaaatttcatctataatgccattcaagatatt
ccaggtttgtctgccgttaaacccaaggcggggctctatatcttcccaaaaatcgaccgc
aatatgtaccgtatcgatgatgatgagcagtttgtccttgatttcttgaagcaggaaaag
gttctcttggttcatggtcgaggctttaactggcaggaaccagaccacttccgtatcgtt
taccttcctcgtgttgatgagttagcccaaatccaagaaaagatgactcgtttcttgaaa
cagtatcgtagatag

DBGET integrated database retrieval system