KEGG   Streptomyces nodosus: CP978_00075
Entry
CP978_00075       CDS       T06839                                 

Definition
(GenBank) 1-epi-valienol-1,7-bisphosphate-1-adenylyltransferase
  KO
K20427  valienol-1-phosphate guanylyltransferase [EC:2.7.7.91]
Organism
snq  Streptomyces nodosus
Pathway
snq00525  Acarbose and validamycin biosynthesis
snq01100  Metabolic pathways
snq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:snq00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00525 Acarbose and validamycin biosynthesis
    CP978_00075
Enzymes [BR:snq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.91  valienol-1-phosphate guanylyltransferase
     CP978_00075
SSDB
Motif
Pfam: NTP_transferase NTP_transf_3 DUF4954
Other DBs
NCBI-ProteinID: QEV37208
UniProt: A0A5P2VUZ6
LinkDB
Position
19559..20680
AA seq 373 aa
MDGVRAVLLAGGEGRRMGPLGHGRLKPLVPFGGTSRLIDFSIANVHRSGLRDVLLLSQYE
ERHLMDDLHLVWNGRHHDFRIHFGPYDAVYRSSPGELPEQMPERTWPMERGTADALLSKA
EYIFGQGDSAASEILVLHADHVYRFDYGSMIREHRASKAALTVSYQRIERRYVHLFGMVE
FDRNGLLTAFEEKPQHPTSDLVFAAFCLFDAATLRRYLEQLNGTDWQHDISRDVIPAMLA
GGEFIRGYEVKSYWEDIGTVDRYHRAHRGLLQAEPTLALADMPLTVAPEVPRRLVLDGPG
GHASIVAADVVNEGKIVDSVVYPGARIGPGAQVVDCVVLPGARVPDGARLSSAVVLEDGS
VQQCEAAREEVAP
NT seq 1122 nt   +upstreamnt  +downstreamnt
atggacggagtacgtgccgtactgctggcgggcggcgaaggccggcgcatggggccgttg
gggcacggcaggctcaagccgctggtgccgttcggcggcacctcccgcctgatcgacttc
agcatcgccaacgtccaccggtcgggcttgcgggatgtcctgttgttgtcccagtacgag
gaacgccacctcatggacgacctgcatctggtgtggaacgggcgccaccacgactttcga
atacacttcggcccctacgacgcggtgtaccggagttcaccgggcgagctgcccgagcag
atgccggagcgcacgtggccgatggagcgcggcacagccgacgcactgctcagcaaggcc
gagtacatcttcggacagggtgactcagcggcctcggaaatcctcgttctccatgcggac
cacgtctaccgtttcgactacggcagcatgatccgcgagcaccgcgcgtcaaaggccgcg
ctgaccgtctcgtatcagcgcatcgagcggcggtacgtgcacctgttcggcatggttgag
ttcgacaggaacggcttgctcacagccttcgaggagaagcctcagcaccccaccagcgac
ctggtgttcgctgctttctgcctcttcgacgcggcaacgctgcggcgttacctggaacag
ctgaacggcacggactggcagcacgacatcagcagggatgtcatcccggccatgctggcc
ggcggcgaattcatccgtgggtatgaggtcaagagctactgggaggacatcggcaccgtg
gaccgctaccaccgtgctcaccgcggactgctgcaggccgagccgacgctcgcgttggcc
gacatgccgctcaccgtggcccccgaggtgccgcggcgcctcgtcctagacgggcccggc
ggccacgccagtatcgtggcggccgacgtggtgaacgagggcaagatcgtggacagtgtg
gtgtacccaggcgcacgcatcggtcccggagcacaggtggtcgactgcgtcgtgctgccg
ggcgcccgggtacccgacggagcacgcctgtcgtcggccgtcgtgctggaggacggctcc
gtccagcagtgcgaggcggcacgggaagaggtcgcaccgtga

DBGET integrated database retrieval system