KEGG   Streptomyces noursei: SNOUR_07205
Entry
SNOUR_07205       CDS       T04806                                 

Definition
(GenBank) 2-amino-3,7-dideoxy-D-threo-hept-6-ulosonate synthase
  KO
K18287  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase [EC:4.1.2.56]
Organism
snr  Streptomyces noursei
Pathway
snr00997  Biosynthesis of various secondary metabolites - part 3
snr01100  Metabolic pathways
snr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:snr00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various secondary metabolites - part 3
    SNOUR_07205
Enzymes [BR:snr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.56  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase
     SNOUR_07205
SSDB
Motif
Pfam: DeoC Asparaginase_C
Other DBs
NCBI-ProteinID: ANZ14760
UniProt: A0A1B2GLE4
LinkDB
Position
1600952..1601788
AA seq 278 aa
MAEAYCRAGKHRRLQRLRHPDSGAIFLIPLDHSLADGPVADTENFASLVEAMANNGVDGL
VVHKGRVRFLRPELLRDLSLIVHLNGSTRYAPDANAKILVGSVEEAVALGADAVSVHVNI
GSDNEAAQLIDLGKVSDQAAHWGVPLLAMVYPRGPHLTNPADPALLAHAANIAADLGADI
VKLPYTGSVSTMVDVVHASPIPIVTAGGGVVAETEKLLDGITDAMASGVAGVAVGRNVFG
AADPGHTARLIAQRVHATAPPPDLLPAERQMDRATTFS
NT seq 837 nt   +upstreamnt  +downstreamnt
atggccgaagcatattgccgggctggaaagcaccggcgcttacagcgccttcgtcatccg
gactctggggcgatcttcctgattccactggaccattcactggctgatggtccggtagcg
gataccgagaatttcgcttcactggtcgaggcgatggccaacaacggagtggacggactc
gtcgtccacaaagggcgggtccggttcctccgaccggaactgctccgggacttgagcctg
atcgtgcacttgaacggcagcacccgctatgccccggacgccaacgcgaagattctcgtc
ggctccgtggaagaagccgtggcactgggggcggacgcagtcagcgtgcacgtcaacatc
ggttccgacaacgaagccgcacaactcatcgacctgggcaaggtctccgaccaggcggcg
cactggggcgtaccgctgctggccatggtctacccgcgtggcccccatctgacgaatccc
gccgaccccgctctgctggcgcacgccgcgaacatcgcggccgatctcggggccgatatc
gtcaagctgccctacaccggttcggtcagcacgatggtcgatgtcgtccatgccagcccg
atccccatcgtgaccgccggcggcggcgtggtcgccgaaacggagaaactcctcgacggc
atcacggacgcgatggcctccggcgtcgccggcgtcgccgtcgggcgcaatgtcttcggc
gccgccgacccgggacacacggcacgcctcatcgcgcagcgggtgcacgccaccgctccc
ccgccggacctcctgccggcggaacgtcagatggaccgcgcaacaacattttcctga

DBGET integrated database retrieval system