KEGG   Streptomyces noursei: SNOUR_10120
Entry
SNOUR_10120       CDS       T04806                                 

Gene name
eryCIV
Definition
(GenBank) NDP-6-deoxyhexose 3,4-dehydratase
  KO
K13308  dTDP-4-amino-4,6-dideoxy-D-glucose transaminase [EC:2.6.1.33]
Organism
snr  Streptomyces noursei
Pathway
snr00523  Polyketide sugar unit biosynthesis
snr01100  Metabolic pathways
snr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:snr00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    SNOUR_10120 (eryCIV)
Enzymes [BR:snr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.33  dTDP-4-amino-4,6-dideoxy-D-glucose transaminase
     SNOUR_10120 (eryCIV)
SSDB
Motif
Pfam: DegT_DnrJ_EryC1 Aminotran_1_2 Beta_elim_lyase SHMT
Other DBs
NCBI-ProteinID: ANZ15340
UniProt: A0A1B2GN21
LinkDB
Position
2274485..2275690
AA seq 401 aa
MKRSITDLALFGGPSAFLHPLYVGKPTVGDRARFFARLDWALDNNWLTNGGPLARELEDR
IADLAGVKHCIATCNATIALELVLRASGVTGQVIMPSLTFAATPHSASWLGLEPVFCDVD
PETGSIDPDLAASLITPETGAIIGVHLWGRAAPVDALAKVAAEHDVKLFYDAAHALGCTA
GGQPIGGFGAAEVFSFHATKTVMSFEGGAVVTDDSVLADRIRVMHNFGIERDKTISSIGT
NGKMSEAAAAMGLTSLDAFPATRERNRANYSLYRAELHGIPGISLITFDENEENNYQYVI
MQVDQALTGLSRDRLQEILRAEKVLAQPYFSPACHQLKPYRTDPPLRLPHTERLSGRVLA
LPTGPSVSFEDIRRVCSVIRLCASHGEQVNALWDRQGSVTA
NT seq 1206 nt   +upstreamnt  +downstreamnt
gtgaagcggagcatcaccgaccttgcgctcttcggtggcccgtcggctttcttgcaccct
ctctacgtgggcaagccgacggtcggcgaccgggcgaggttcttcgcgcgcctggactgg
gcgctggacaacaactggctcaccaacggcggcccgctggcccgggagttggaggaccga
atcgccgacctcgccggcgtgaagcactgcatagctacctgcaacgccaccatcgcactt
gagctcgtcctgcgtgccagtggcgtcaccggccaggtgatcatgccgtcgctgacattc
gccgccactccgcactccgcgagctggctcggcctggagccggtgttctgcgacgtcgac
cccgaaaccggctccatcgacccggacctggccgcctcgttgatcacaccggagaccggc
gccatcatcggggttcacctgtggggccgggctgcgcccgtggacgcattggcgaaggtc
gcggcggagcacgacgtgaagttgttctacgacgccgcccatgcgctgggctgtaccgcc
ggcggccagccgatcggcggtttcggcgcagcggaggtgttcagtttccacgccaccaag
acggtgatgtcgttcgagggcggcgccgtggtaaccgacgacagcgtgctcgcagaccgg
atccgcgtcatgcacaacttcggcatcgaacgcgacaagacaatcagcagcatcggcacc
aacggcaagatgagtgaagccgccgcggcgatgggcctgacctcgctcgacgctttcccc
gcaaccagagaacgcaaccgcgcgaactactcgctctaccgcgcggaactgcacggcata
ccgggcatcagcctgatcacgttcgacgagaacgaggagaacaactaccagtacgtcatc
atgcaggttgaccaggcgctcactgggctgtcccgcgaccggctccaggagatcctgcgt
gccgagaaggtgctggcacagccgtacttctcccccgcctgtcaccagctgaagccgtat
cggaccgacccaccgctgcgcttgccgcacaccgagcgcctttcggggcgcgtactggcc
ctgcccaccggcccctcggtgtccttcgaggacattcgccgggtgtgcagcgtcatccgg
ctgtgcgcatcccatggcgagcaggtcaacgcgctgtgggaccggcagggttccgtcacg
gcgtga

DBGET integrated database retrieval system