KEGG   Streptomyces noursei: SNOUR_10860Help
Entry
SNOUR_10860       CDS       T04806                                 

Definition
(GenBank) class III aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
snr  Streptomyces noursei
Pathway
snr00250  Alanine, aspartate and glutamate metabolism
snr00410  beta-Alanine metabolism
snr00640  Propanoate metabolism
snr00650  Butanoate metabolism
snr01100  Metabolic pathways
snr01120  Microbial metabolism in diverse environments
Module
snr_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:snr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SNOUR_10860
   00650 Butanoate metabolism
    SNOUR_10860
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SNOUR_10860
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SNOUR_10860
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:snr01007]
    SNOUR_10860
Enzymes [BR:snr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SNOUR_10860
Amino acid related enzymes [BR:snr01007]
 Aminotransferase (transaminase)
  Class III
   SNOUR_10860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: ANZ15486
UniProt: A0A1B2GNH7
LinkDB All DBs
Position
complement(2445567..2446883)
Genome map
AA seq 438 aa AA seqDB search
MTRDPGNLHARHRAVMPSWLSLYYERPLELTHGEGRHVWDAEGNRYLDFFGGILTTMTAH
ALPEVTKAVGEQAGRILHTSTLYLSRPMVELAERIAALSGIPDARVFFTTSGTEANDAAL
LLATTHRRSNQVLAMRNSYHGRSFSTVAITGNQSWSPTSLSPLQTLYVHGGVRSRGPYAD
LGDAEYVAACVADLEDMLQQTAGGVAALIAEPVQGVGGFTAPPDGLYAAFREVLAREGIL
WISDEVQTGWGRTGDHFWGWQAHAENGPPDLLTFAKGIGNGMSLGGVVARAEIMNCLSAN
SISTFGGSPITMAAGLANLNYLLEHDLQGNARRVGGLLIERLRAVAAGLDVVREIRGRGL
MIGIELVRPGTDERSPEAATLVLEAARERGLLIGKGGQGGASLRIAPPLTLTVAEAEQGA
ELLADALRQAQRQLADAS
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
gtgacccgcgaccccgggaacctgcacgcccggcaccgcgcggtgatgccctcctggttg
agcctctactacgaacgacccctggagctcacccacggcgagggacggcacgtctgggac
gccgagggcaaccgctacctcgacttcttcggcggcatcctcaccaccatgaccgcgcac
gctctgcccgaggtgaccaaggcggtcggcgaacaggccggccggatcctgcacacctcc
acgctctacctctcccgccccatggtggagctggcggagcggatcgccgcgctctccggc
atccccgacgcccgggtcttcttcaccacctccggcaccgaggccaacgacgccgccctg
ctgctcgccaccacccatcgccgctccaaccaggtgctggcgatgcgcaacagctaccac
ggccggtcgttctccaccgtcgccatcaccggcaaccagagctggtcgcccaccagcctc
tcgcccctgcagaccctctacgtgcacggcggggtgcgttcccgtggcccgtacgccgac
ctcggcgacgcggagtacgtcgcggcctgcgtcgcggacctggaggacatgctccagcag
accgccggcggcgtcgccgcgctgatcgccgaaccggtgcagggcgtcggcggcttcacc
gccccgccggacgggctgtacgcggcgttccgcgaggtgctggcccgcgaggggatcctg
tggatcagcgacgaggtgcagaccggctggggccgcaccggcgaccacttctggggctgg
caggcgcacgccgagaacggcccgcccgacctgctcaccttcgccaagggcatcggcaac
ggcatgtccctcggcggggtggtggcccgcgccgagatcatgaactgcctgtccgccaac
tccatctcgaccttcggcggcagcccgatcaccatggccgcgggcctggccaacctcaac
tacctgctggagcacgacctccagggcaacgcccggcgggtcggcgggctgctcatcgag
cggctgcgggcggtggcagccgggctggacgtggtgcgggagatccgcggccggggcctg
atgatcgggatcgagctggtccggccgggcaccgacgagcgctcgccggaggccgccacg
ctggtgctggaggccgcccgcgagcgcggtctgctgatcggcaagggcggccagggcggc
gcctcgctccgcatcgcgccgccgctcacgctcaccgtcgccgaggcggagcagggcgcg
gaactgctcgcggacgccctgcggcaggcccagcggcagctcgcggacgcgtcgtag

DBGET integrated database retrieval system