KEGG   Streptomyces noursei: SNOUR_15155Help
Entry
SNOUR_15155       CDS       T04806                                 

Gene name
sodN
Definition
(GenBank) Superoxide dismutase (Ni)
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
snr  Streptomyces noursei
Brite
Enzymes [BR:snr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SNOUR_15155 (sodN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni BtrH_N
Motif
Other DBs
NCBI-ProteinID: ANZ16332
UniProt: A0A1B2GR10
LinkDB All DBs
Position
3494189..3494584
Genome map
AA seq 131 aa AA seqDB search
MLSRLFAPKVKVSAHCDLPCGVYDPAQARIEAESVKAVQEKYQANEDADFRTRAVLIKEQ
RAELAKHHISVLWSDYFKPPHFEKYPQLHQLVNDTLKALSAAKASNDPKTGTKALELIAE
IDKIFWETKKG
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgctttcccgcctgttcgcccccaaggtcaaggtcagcgcgcactgcgacctgccctgc
ggcgtgtacgacccggcccaggcccgcatcgaggccgagtcggtcaaggccgtacaggag
aagtaccaggccaacgaggacgcggacttccgcacccgcgccgtcctgatcaaggagcag
cgggccgagctggccaagcaccacatctcggtgctgtggagcgactacttcaagcccccg
cacttcgagaagtacccgcagctccaccagctggtcaacgacacgctcaaggccctcagc
gcggccaaggcttcgaacgacccgaagacgggcacgaaggccctggagctcatcgccgag
atcgacaagatcttctgggagacgaagaagggctga

DBGET integrated database retrieval system