KEGG   Streptomyces noursei: SNOUR_16950Help
Entry
SNOUR_16950       CDS       T04806                                 

Definition
(GenBank) succinate dehydrogenase subunit A
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
snr  Streptomyces noursei
Pathway
snr00020  Citrate cycle (TCA cycle)
snr00190  Oxidative phosphorylation
snr00650  Butanoate metabolism
snr01100  Metabolic pathways
snr01110  Biosynthesis of secondary metabolites
snr01120  Microbial metabolism in diverse environments
snr01130  Biosynthesis of antibiotics
snr01200  Carbon metabolism
Module
snr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
snr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
snr_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:snr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SNOUR_16950
   00650 Butanoate metabolism
    SNOUR_16950
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SNOUR_16950
Enzymes [BR:snr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SNOUR_16950
    1.3.5.4  fumarate reductase (quinol)
     SNOUR_16950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C HI0933_like Pyr_redox_2 Thi4 DAO Pyr_redox_3 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: ANZ16689
UniProt: A0A1B2GS25
LinkDB All DBs
Position
3881835..3883589
Genome map
AA seq 584 aa AA seqDB search
MQIHKYDTVIVGAGGAGMRAAIEATKRSRTAVLTKLYPTRSHTGAAQGGMAAALANVEED
NWEWHTFDTVKGGDYLVDQDAAEILAKEAIDSVLDLEKMGLPFNRTPEGRIDQRRFGGHS
RNHGEAPVRRSCYAADRTGHMILQTLYQNCVKEGVEFFNEFYVLDQLITEVDGVKKSAGV
VAYELATGEIHVFQAKSVIYASGGTGKFFKVTSNAHTLTGDGQAACYRRGLPLEDMEFFQ
FHPTGIWRMGILLTEGARGEGGILRNKDGERFMEKYAPVMKDLASRDVVSRSIYTEIREG
RGCGPDGDHVYLDLTHLPPEQLDAKLPDITEFARTYLGIEPYTDPIPIQPTAHYAMGGIP
TNVEGEVLADNTTVVPGLFAAGEVACVSVHGANRLGTNSLLDINVFGRRAGIAAAEYSAT
ADFVELPENPASLVAEQVERLRNSTGGERVAELRKELQECMDANVMVFRTEQTIKTAVEK
IAELRERYRNVAIQDKGKRFNTDLLEAIELGNLLDLAEVMAVSALARKESRGGHYREDYP
NRDDVNFMRHTMAYREVGADGSESIRLDYKPVVQTRYQPMERKY
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgcagatccacaagtacgacaccgtcatcgtcggcgccggcggcgccggcatgcgcgcc
gccatcgaggcgacgaagcgcagccgcaccgccgtgctgaccaagctctacccgacccgc
tcccacaccggtgccgcccagggcggcatggccgcggccctcgccaacgtcgaggaggac
aactgggagtggcacaccttcgacacggtcaagggcggtgactacctggtcgaccaggac
gccgccgagatcctggcgaaggaggccatcgactcggtcctcgacctggagaagatgggc
ctgcccttcaaccgcacgccggagggccggatcgaccagcgccggttcggcggtcactcc
cgcaaccacggcgaggccccggtccgccggtcctgctacgccgcggaccgcaccggccac
atgatcctccagacgctgtaccagaactgcgtcaaggagggcgtggagttcttcaacgag
ttctacgtcctggaccagctgatcaccgaggtcgacggcgtcaagaagtcggccggtgtg
gtcgcctacgagctggccaccggcgagatccacgtcttccaggcgaagtcggtcatctac
gcctcgggcggcaccggcaagttcttcaaggtgacgtcgaacgcgcacaccctgaccggt
gacggccaggccgcgtgctaccggcgcgggctgccgctggaggacatggagttcttccag
ttccacccgaccggcatctggcggatgggcatcctgctgacggagggcgcccgcggtgag
ggcggcatcctccgcaacaaggacggcgagcgcttcatggagaagtacgcgcccgtcatg
aaggacctcgcctcgcgtgacgtcgtctcgcgctccatctacacggagatccgcgagggc
cgcggctgcggtcccgacggcgaccacgtctacctggacctgacgcacctgccgccggag
cagctggacgccaagctgccggacatcaccgagttcgcgcgcacctacctcggcatcgag
ccctacacggacccgatcccgatccagccgaccgcgcactacgccatgggcggcatcccg
accaacgtcgagggtgaggtcctggcggacaacaccaccgtcgtgccgggcctgttcgcc
gccggcgaggtcgcctgcgtctccgtgcacggcgccaaccgcctgggcaccaactcgctg
ctggacatcaacgtcttcggccgccgggccggcatcgcggccgcggagtactcggccacc
gccgacttcgtcgagctgcccgagaacccggcgtcgctggtcgccgagcaggtcgagcgg
ctgcgcaactccaccggtggcgagcgggtcgcggagctgcgcaaggagctccaggagtgc
atggacgccaacgtgatggtgttccgcaccgagcagacgatcaagaccgcggtcgagaag
atcgccgagctgcgcgagcgctaccggaacgtggcgatccaggacaagggcaagcgcttc
aacaccgacctgctggaggccatcgagctgggcaacctgctcgacctggccgaggtcatg
gcggtgtccgcgctggcccgcaaggagtcccgcggcggtcactaccgcgaggactacccc
aaccgcgacgacgtcaacttcatgcggcacaccatggcgtaccgcgaggtgggcgccgac
ggttccgagtcgatccggctcgactacaagccggtcgtgcagacccgctaccagccgatg
gagcgtaagtactga

DBGET integrated database retrieval system