KEGG   Streptomyces noursei: SNOUR_16955Help
Entry
SNOUR_16955       CDS       T04806                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
snr  Streptomyces noursei
Pathway
snr00020  Citrate cycle (TCA cycle)
snr00190  Oxidative phosphorylation
snr00650  Butanoate metabolism
snr01100  Metabolic pathways
snr01110  Biosynthesis of secondary metabolites
snr01120  Microbial metabolism in diverse environments
snr01130  Biosynthesis of antibiotics
snr01200  Carbon metabolism
Module
snr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
snr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
snr_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:snr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SNOUR_16955 (sdhB)
   00650 Butanoate metabolism
    SNOUR_16955 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SNOUR_16955 (sdhB)
Enzymes [BR:snr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SNOUR_16955 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     SNOUR_16955 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_17 Fer4_7 Fer4_9 Fer4_16 Fer4 Fer4_4 Fer4_18 Fer4_6 Fer4_2 Fer4_21 Fer2 Fer4_15
Motif
Other DBs
NCBI-ProteinID: ANZ16690
UniProt: A0A1B2GRX7
LinkDB All DBs
Position
3883589..3884362
Genome map
AA seq 257 aa AA seqDB search
MSTPTIDKHSAALDAAENDAAHLISVTFRIRRFNPEVSEEAGWQDFQLEIDPKERVLDAL
HKIKWDQDGSLTFRRSCAHGICGSDAMRINGRNRLACKTLIKDINPEKPITVEAIKGLTV
LKDLVVDMEPFFQAYRDVMPFLITTGNEPTRERLQSSEDRERFDDTTKCILCAACTSSCP
VFWNDGQYFGPAAIVNAHRFIFDSRDEGGEQRLEILNDKDGVWRCRTTFNCTDACPRGIE
VTKAIQEVKRALITRRF
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccccgaccatcgacaagcactccgcggccctggacgcggccgagaacgacgct
gcgcacctgatcagcgtcaccttccggatccgccggttcaacccggaggtctccgaggag
gccggctggcaggacttccagctggagatcgaccccaaggagcgcgtcctggacgccctc
cacaagatcaagtgggaccaggacggctcgctcaccttccgccgctcctgcgcgcacggc
atctgcggctcggacgccatgcggatcaacggtcgcaaccggctggcctgcaagacgctg
atcaaggacatcaaccccgagaagccgatcaccgtcgaggccatcaagggcctgacggtg
ctgaaggaccttgtcgtcgacatggagcccttcttccaggcgtaccgggacgtgatgccg
ttcctgatcaccaccggcaacgagccgacccgcgagcgcctgcagtcctccgaggaccgc
gagcgcttcgacgacaccaccaagtgcatcctgtgcgcggcctgcaccagctcgtgcccc
gtgttctggaacgacggccagtacttcggcccggcggcgatcgtcaacgcgcaccgcttc
atcttcgactcgcgtgacgagggcggcgagcagcggctggagatcctcaacgacaaggac
ggcgtctggcgctgccggacgaccttcaactgcacggacgcctgcccgcgcggtatcgag
gtcaccaaggcgatccaggaggtcaagcgggccctgatcacccggcggttctga

DBGET integrated database retrieval system