KEGG   Streptomyces noursei: SNOUR_19190Help
Entry
SNOUR_19190       CDS       T04806                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
snr  Streptomyces noursei
Pathway
snr00250  Alanine, aspartate and glutamate metabolism
snr00410  beta-Alanine metabolism
snr00430  Taurine and hypotaurine metabolism
snr00650  Butanoate metabolism
snr01100  Metabolic pathways
snr01110  Biosynthesis of secondary metabolites
snr01120  Microbial metabolism in diverse environments
snr02024  Quorum sensing
Module
snr_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:snr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SNOUR_19190
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SNOUR_19190
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SNOUR_19190
   00430 Taurine and hypotaurine metabolism
    SNOUR_19190
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SNOUR_19190
Enzymes [BR:snr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     SNOUR_19190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ANZ17133
UniProt: A0A1B2GT70
LinkDB All DBs
Position
4383813..4385228
Genome map
AA seq 471 aa AA seqDB search
MTLHKGGSEREPRRRTHPVNPFYGEADPVAGMETSPPRHTLPAGPISPHTAYQFVHDELM
LDGNARLNLATFVTTWMEPQADVLMSECQAKNMIDKDEYPRTAELERRCVAMLAHLWHAP
DPSAAMGCSTTGSSEACMLAGMALKRRWARRNPDRYPGTARPNLVMGANVQVCWEKFCNF
WEVETRQVPMEGDRFHLDADSATALCDENTIGVVAVLGSTFDGSYEPVAEICTALDALQE
RTGLDVPVHVDGASGGMIAPFLDPDLLWDFRLPRVASINTSGHKYGLVYPGVGWALWRDQ
DALPEELVFRVNYLGGDMPTFALNFSRPGAQVAAQYYTFLRLGREGFRAVQQATRDVAGS
MAERIGALGDFRLLTQGDQLPVFAFTTADDVTSFDVFDVSRRLRERGWLVPAYTFPPNRQ
DLSVLRVVCRNGFSLDLADSFLADLEQLLPELRRQPAPLDRPENIATAFHH
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgcacaaaggcggctccgaacgggagccccggcgccgcacccacccggtcaac
cccttctacggcgaggccgacccggtcgccgggatggagacctctcccccgcggcacacc
ctccccgcgggccccatctccccgcacaccgcctaccagttcgtccacgacgaactgatg
ctggacggcaacgcccggctcaacctcgccaccttcgtcaccacctggatggagccgcag
gccgacgtcctgatgtcggagtgccaggccaagaacatgatcgacaaggacgagtacccg
cgcaccgccgaactggaacggcgctgcgtggcgatgctcgcccacctctggcacgccccc
gacccgtccgccgccatgggctgctccaccaccggctccagcgaagcctgcatgctcgcc
ggcatggccctcaagcgccgctgggcccggcgcaaccccgaccgctatcccggcaccgcc
cgccccaacctcgtcatgggcgccaacgtccaggtctgctgggagaagttctgcaacttc
tgggaggtggagacccgccaggtccccatggagggcgaccgcttccacctggacgcggac
tccgccaccgcgctctgcgacgagaacaccatcggtgtcgtcgccgtcctgggctcgacc
ttcgacggctcctacgagccggtggcggagatctgcaccgccctcgacgcgctccaggag
cgcaccggcctggacgtccccgtccacgtggacggcgcgtccggcggcatgatcgcaccg
ttcctcgaccccgacctgctgtgggacttccgcctcccccgggtcgcctccatcaacacc
tccggccacaagtacggcctggtctaccccggcgtcggctgggcgctctggcgcgaccag
gacgcgctccccgaggagctggtcttccgcgtcaactacctgggcggcgacatgccgacc
ttcgccctcaacttctcccgccccggcgcccaggtcgccgcccagtactacaccttcctc
cggctgggccgggagggcttccgcgccgtccagcaggccacccgcgacgtggccggctcg
atggccgaacggatcggcgcgctgggcgacttccgtctgctcacccagggcgaccagctg
ccggtcttcgccttcaccaccgccgacgacgtcacgtccttcgacgtcttcgacgtgtcc
cggcgactgcgggagcgcggctggctggtccccgcctacaccttcccgcccaaccgccag
gacctctccgtcctccgggtggtctgccgcaacggcttctcgctggacctggccgacagc
ttcctggccgacctggagcagctgctccccgaactccgccgacagcccgccccgttggac
cgcccggagaacatcgccaccgccttccaccactga

DBGET integrated database retrieval system