KEGG   Streptomyces noursei: SNOUR_22130Help
Entry
SNOUR_22130       CDS       T04806                                 

Definition
(GenBank) Kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
snr  Streptomyces noursei
Pathway
snr00380  Tryptophan metabolism
snr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:snr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    SNOUR_22130
Enzymes [BR:snr01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     SNOUR_22130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: ANZ17709
UniProt: A0A1B2GUX7
LinkDB All DBs
Position
5009545..5010903
Genome map
AA seq 452 aa AA seqDB search
MSESRETPKSPGPAVAGARKAAIRAAELDAAGPLTTTRERFVLDDTVYLDGNSLGALPRS
VPDRIAEVIRHEWGELRIRSWTEAGWWTAPERIGEKIAPLVGAAPGQVVVGDSTSINVFK
AVTGGIRMAGKGCTEILVDATTFPTDGYIARSAARMAGLAVRPVEPARIADEVTERTALA
LVNHVDYRTGELNDMASITAALHSAGALAVWDLCHSAGALPVALDACGVDLAVGCTYKYL
NGGPGSPAYLYVRKSLQERFESPLPGWNSHVDPFGMEPGYTPADGVLRGRVGTPDILSML
ALEAALEVWEGVAIEDVRAKSLALTDFFLECVSEYAPPGRVRSVTPHEHRRRGSQVSLAC
SPGVSSAAAQGGAPVAGEVMAELIRRGVVGDFRPPDVLRFGFTPLYTTFADAERAAWVLG
EVLREQPAAESASGPEPASASAQESAAGGDAG
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagagccgtgagaccccgaagagccccggcccggccgtcgccggggcgcgcaag
gcggcgatccgcgccgccgaactggacgccgccgggccgctgaccacgacccgcgagagg
ttcgtcctcgacgacaccgtctatctcgacggcaactcgctcggcgcgctgccccggtcg
gtgcccgaccggatcgccgaggtgatccgccacgagtggggcgagctgcgcatccgctcc
tggaccgaggccggctggtggaccgcgcccgagcggatcggcgagaagatcgccccgctc
gtcggggcggccccgggccaggtggtggtcggcgactccaccagcatcaacgtcttcaag
gcggtgaccggcggcatccggatggccggcaagggctgcacggagatcctggtcgacgcc
acgaccttccccaccgacggctatatcgcccgctccgcggcccggatggccggcctcgcg
gtgcggccggtcgagcccgcgcggatcgccgacgaggtcaccgagcggaccgcgctggcg
ctggtcaaccacgtcgactaccgcaccggcgagctcaacgacatggcctcgatcaccgcc
gcgctgcacagcgcgggcgcgctggcggtctgggacctgtgccacagcgccggtgcgctg
ccggtcgcgctggacgcgtgcggggtcgacctcgcggtgggctgcacctacaagtacctc
aacggcggcccgggttcgcccgcgtacctctacgtccgcaagagcctccaggagcggttc
gagtcgccgctgcccggctggaactcgcacgtcgacccgttcgggatggagccgggctac
accccggccgacggtgtcctgcgcggtcgcgtcggcacccccgacatcctctcgatgctg
gccctggaggcggcgctggaggtgtgggagggggtcgccatcgaggacgtgcgcgccaag
agcctggcgctgaccgacttcttcctggagtgcgtgtcggagtacgcgccgcccggccgg
gtccgctcggtcaccccgcacgagcaccggcggcgcggcagccaggtctcgctggcgtgt
tcccccggggtctcctccgcggccgcgcaggggggtgctcccgtggccggtgaggtgatg
gcggagctgatccggcgcggtgtggtcggcgacttccggcccccggacgtgctgcgcttc
ggcttcaccccgctctacaccaccttcgcggacgcggagcgggcggcgtgggtgttgggc
gaggtgctgcgggagcagcccgcggcggagtccgcgtcagggccggagccggcgtcggca
tcggcgcaggagtccgcggccggcggcgacgccgggtga

DBGET integrated database retrieval system