KEGG   Streptomyces noursei: SNOUR_24730Help
Entry
SNOUR_24730       CDS       T04806                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase, type 1
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
snr  Streptomyces noursei
Pathway
snr00620  Pyruvate metabolism
snr00680  Methane metabolism
snr01100  Metabolic pathways
snr01120  Microbial metabolism in diverse environments
snr01200  Carbon metabolism
Module
snr_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:snr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SNOUR_24730 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    SNOUR_24730 (ppc)
Enzymes [BR:snr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SNOUR_24730 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase FtsQ
Motif
Other DBs
NCBI-ProteinID: ANZ18213
UniProt: A0A1B2GWC4
LinkDB All DBs
Position
5570338..5573103
Genome map
AA seq 921 aa AA seqDB search
MSSADNTPAEPATSGTPQGTSGDNGALRADIRRLGDLLGETLVRQEGQDLLDLVEQVRAL
TRTDGEAAARLLGETDLATAAKLVRAFSTYFHLANVTEQVHRGRELRARRAAEGSILART
ADMLKDADPEHLRETARNLGVRPVFTAHPTEAARRSVLTKLRKIAELLDRIDAADRRRVD
LRLAENIDLIWQTDELRVARPEPTDEARNAIYYLDELGRGAVGDVLEDLAAELARAGTEL
PAGTRPLTFGTWIGGDRDGNPNVTPQVTWDVLILQHEHGITDALEHVDELRGALSNSIRN
CGATDELLASLQRDLDLLPEISPRYKRLNSEEPYRLKATCIRQKLLNTRERLASDTPHVP
GRDYLGTSELLDDLTLIQTSLRAHRGGLIADGRLERTLRTIGAFGLQLATMDVREHADAH
HHALGQLFDRLGEESWRYVDMPRDYRRKLLAKELRSRRPLAPTPPPLDEAGAKTLGVFRT
IRQAKKTFGPEVIESYIISMCQGSDDVFAAAVLAREAGLIDLHAGWAKIGIVPLLETTDE
LKIADQLLDDMLSDPSYRRLVALRGDVQEVMLGYSDSSKFGGITTSQWEIHRAQRLLRDV
AHRHGVRLRLFHGRGGTVGRGGGPSHDAILAQPYGTLEGEIKVTEQGEVISDKYLVPSLA
RENLELTVAATLQASALHTAPRQSDEALARWDAAMETVSEAAHGAYRRLVEDPDLPAYFF
ASTPVDQLAELHLGSRPSRRPDSGAGLDGLRAIPWVFGWTQSRQIVPGWFGVGTGLKAAR
EAGLDTVLDEMHEHWHFFRNFLSNVEMTLAKTDLRIAQHYVDTLVPDELRHVFDVIRAEH
ELTVAEVLRVTGEAELLDSNPVLQQTFHVRDAYLDPISYLQVTLLKRQRDAAAAEEQPDP
LLSRALLLTVNGVAAGLRNTG
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagtgccgacaacacccccgccgagcccgccacctccggaactccccagggcacc
agcggtgacaacggtgccctgcgcgccgacatccgccgcctcggcgacctcctcggcgag
accctcgtccggcaggaaggtcaggacctcctcgacctcgtcgaacaggtccgcgccctg
acccgcaccgacggcgaggccgccgcccggctcctcggcgagaccgacctggccaccgcc
gccaagctggtccgcgccttctccacctacttccacctggcgaacgtcaccgagcaggtc
caccgcggtcgcgagctgcgcgcccggcgcgccgccgagggcagcatcctcgcccgcacc
gccgacatgctcaaggacgccgaccccgagcacctgcgggagaccgcccgcaacctcggc
gtccgcccggtcttcaccgcccaccccaccgaggccgcccgccgctccgtcctcaccaag
ctccgcaagatcgccgagctgctggaccgcatcgacgccgccgaccgccgccgggtggat
ctccgcctcgccgagaacatcgacctcatctggcagaccgacgagctgcgggtggcccgc
cccgagcccaccgacgaggcccggaacgccatctactacctcgacgagctcggccgcggc
gcggtcggcgacgttctggaggacctcgccgccgaactcgcacgcgccggcaccgagctg
cccgccggcacccgcccgctgaccttcggcacctggatcggcggcgaccgcgacggcaac
cccaacgtcaccccccaggtcacctgggacgtcctgatcctccagcacgagcacggcatc
accgacgccctggagcacgtcgacgaactccgcggcgccctctccaactccatccgcaac
tgcggcgccaccgacgaactcctcgcctccctccagcgggacctcgacctcctccccgag
atcagcccccgctacaagcgcctcaacagcgaagagccctaccgcctcaaggccacctgc
atccgccagaagctcctcaacacccgcgagcggctggccagcgacaccccccacgtcccc
ggccgcgactacctcggcaccagcgaactcctcgacgacctcaccctgatccagacctcg
ctgcgcgcccaccgcggcggcctgatcgccgacggccgcctggagcgcaccctgcgcacc
atcggcgcgttcggcctccagctcgccaccatggacgtccgcgagcacgccgacgcccac
caccacgccctcggccagctcttcgaccgcctcggcgaggagtcctggcgctacgtggac
atgccgcgcgactaccgccgcaagctcctcgccaaggagctccgctcccgccggccgctc
gcccccaccccgccgcccctcgacgaggccggcgccaagaccctcggcgtcttccgcacc
atccgccaggccaagaagaccttcggccccgaggtcatcgagtcctacatcatctcgatg
tgccagggctccgacgacgtcttcgccgccgccgtcctcgcccgcgaggccggtctgatc
gacctgcacgccggctgggccaagatcggcatcgtcccgctgctggagaccaccgacgag
ctgaagatcgccgaccagctcctcgacgacatgctctccgacccctcctaccgccgcctg
gtcgccctgcgcggcgacgtccaggaggtcatgctcggctactccgactcctccaagttc
ggcggcatcaccaccagccagtgggagatccaccgcgcccagcgcctgctccgcgacgtc
gcccaccggcacggcgtccggctgcggctcttccacggccgcggcggcaccgtcggccgc
ggcggcggcccctcccacgacgcgatcctcgcccagccctacggcaccctcgaaggcgag
atcaaggtcaccgagcagggcgaggtcatctccgacaagtacctcgtgccgtcgctcgcc
cgggagaacctggagctgacggtcgccgcgaccctccaggcgtccgcgctgcacaccgcc
ccccgccagtccgacgaggccctggcccgctgggacgccgcgatggagaccgtctccgaa
gccgcccacggcgcctaccgccggctcgtcgaggaccccgacctgcccgcctacttcttc
gcctccacccccgtcgaccagctcgccgagctccacctcggctcccgcccgtcccgccgc
cccgactccggcgccggcctcgacggcctccgcgccatcccgtgggtcttcggctggacc
cagtcccggcagatcgtccccggctggttcggcgtcggcaccggcctcaaggccgcccgc
gaggccggcctggacaccgtcctcgacgagatgcacgagcactggcacttcttccgcaac
ttcctgtccaacgtcgagatgacgctggccaagaccgacctgcggatcgcccagcactac
gtcgacaccctcgtcccggacgagctccggcacgtcttcgacgtcatcagggccgagcac
gagctgaccgtcgccgaggtgctgcgcgtcaccggcgaggccgaactcctcgactccaac
ccggtgctccagcagaccttccacgtccgcgacgcctacctggacccgatctcctacctc
caggtcactctcctcaagcgccagcgcgacgccgccgcggccgaggagcagcccgacccg
ctgctctcccgcgccctcctcctcaccgtcaacggcgtggccgccggcctccgcaacacc
ggctga

DBGET integrated database retrieval system